KEGG   Rhodospirillum centenum: RC1_2038Help
Entry
RC1_2038          CDS       T00785                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rce  Rhodospirillum centenum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2097773..2098912)
Genome map
AA seq 379 aa AA seqDB search
MLFAETKEVAAQLSAAALERLRANGVAPTPEHYTVWYAHFSGRFPALSRAIDILETNQAQ
VGEAHCADLYERFFGMEAEHDAVHVASEKLGSALESVMAALREAGADVGRYHDVLATARG
QLDLAATLEQLKALVRSVADETARMARNNQALEAQLSESAVQIESMRHDLAVVRQEALTD
ALTGIANRKRFDQVLRAAAGQAMESGRPLALAMIDIDRFKLFNDTHGHVAGDQVLRLVAR
TLADSVRGSDTPSRFGGEEFALVMPDTPLTAGVSVAERIRRATAGRQIVKRTSGESMGSI
TLSAGVAIYRPGETLAAFVQRADAALYAAKAGGRNRVVADAADFAAQPPEDVAAPDPQVP
GRAGPEKGAASQGRATGTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttcgcggaaacgaaggaagtggcggcgcagctctctgcggcggcgctggagcgc
ctccgggcaaacggcgtggcccccacgccggagcactacacggtctggtacgcccatttc
agcggccgcttccccgcgctcagccgggccatcgacatcctcgaaacgaatcaggcccag
gtgggggaggcgcactgcgccgacctctacgagcgcttcttcgggatggaggcggagcac
gacgccgtccatgtcgccagcgagaagctgggctccgccctcgaatcggtgatggccgcc
ctgcgcgaggccggggccgatgtcggccgctaccacgatgtcctggcgaccgcccgcggg
cagctcgacctcgccgcgacgctggagcagctcaaggcgctggtccgctccgtcgcggac
gagacggcgcggatggcccgcaacaaccaggcgctggaggcgcagctttccgaaagcgcc
gtgcagatcgagtcgatgcgccacgatctggccgtggtccggcaggaggcgctgacggac
gcgctgactggcatcgccaaccgcaagcgcttcgaccaggtgctgcgcgccgccgccggg
caggcgatggaatcgggccggccgctggcgctggcgatgatcgacatcgaccgcttcaag
ctcttcaacgacacccacggccatgtcgccggcgatcaggtgctgcgtctggtcgcccga
accctggcggacagcgtgcgcggcagcgacacgccgtcccgcttcggcggggaggagttc
gcgctggtgatgccggacacgccgctgaccgccggcgtctccgtggccgagcgcatccgc
cgcgccaccgccggccgccagatcgtcaagcgcacctcgggcgaatcgatgggcagcatc
acgctgtcggcgggcgttgccatctaccggccgggggagacgctggccgccttcgtgcag
cgggcggatgccgcgctctatgccgccaaggcgggtgggcgcaaccgggtggtggcggat
gcggcggacttcgccgcccagccgccggaggatgtcgccgcgcccgacccgcaggttccc
ggcagggccgggccggagaagggggcggcgtcccagggcagggccaccgggacacgctga

DBGET integrated database retrieval system