KEGG   Rhodospirillum centenum: RC1_2038Help
Entry
RC1_2038          CDS       T00785                                 

Definition
(GenBank) diguanylate cyclase, putative
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rce  Rhodospirillum centenum
Brite
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     RC1_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2097773..2098912)
Genome map
AA seq 379 aa AA seqDB search
MLFAETKEVAAQLSAAALERLRANGVAPTPEHYTVWYAHFSGRFPALSRAIDILETNQAQ
VGEAHCADLYERFFGMEAEHDAVHVASEKLGSALESVMAALREAGADVGRYHDVLATARG
QLDLAATLEQLKALVRSVADETARMARNNQALEAQLSESAVQIESMRHDLAVVRQEALTD
ALTGIANRKRFDQVLRAAAGQAMESGRPLALAMIDIDRFKLFNDTHGHVAGDQVLRLVAR
TLADSVRGSDTPSRFGGEEFALVMPDTPLTAGVSVAERIRRATAGRQIVKRTSGESMGSI
TLSAGVAIYRPGETLAAFVQRADAALYAAKAGGRNRVVADAADFAAQPPEDVAAPDPQVP
GRAGPEKGAASQGRATGTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttcgcggaaacgaaggaagtggcggcgcagctctctgcggcggcgctggagcgc
ctccgggcaaacggcgtggcccccacgccggagcactacacggtctggtacgcccatttc
agcggccgcttccccgcgctcagccgggccatcgacatcctcgaaacgaatcaggcccag
gtgggggaggcgcactgcgccgacctctacgagcgcttcttcgggatggaggcggagcac
gacgccgtccatgtcgccagcgagaagctgggctccgccctcgaatcggtgatggccgcc
ctgcgcgaggccggggccgatgtcggccgctaccacgatgtcctggcgaccgcccgcggg
cagctcgacctcgccgcgacgctggagcagctcaaggcgctggtccgctccgtcgcggac
gagacggcgcggatggcccgcaacaaccaggcgctggaggcgcagctttccgaaagcgcc
gtgcagatcgagtcgatgcgccacgatctggccgtggtccggcaggaggcgctgacggac
gcgctgactggcatcgccaaccgcaagcgcttcgaccaggtgctgcgcgccgccgccggg
caggcgatggaatcgggccggccgctggcgctggcgatgatcgacatcgaccgcttcaag
ctcttcaacgacacccacggccatgtcgccggcgatcaggtgctgcgtctggtcgcccga
accctggcggacagcgtgcgcggcagcgacacgccgtcccgcttcggcggggaggagttc
gcgctggtgatgccggacacgccgctgaccgccggcgtctccgtggccgagcgcatccgc
cgcgccaccgccggccgccagatcgtcaagcgcacctcgggcgaatcgatgggcagcatc
acgctgtcggcgggcgttgccatctaccggccgggggagacgctggccgccttcgtgcag
cgggcggatgccgcgctctatgccgccaaggcgggtgggcgcaaccgggtggtggcggat
gcggcggacttcgccgcccagccgccggaggatgtcgccgcgcccgacccgcaggttccc
ggcagggccgggccggagaagggggcggcgtcccagggcagggccaccgggacacgctga

DBGET integrated database retrieval system