KEGG   Rhodospirillum centenum: RC1_2081Help
Entry
RC1_2081          CDS       T00785                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RC1_2081 (bchI)
Enzymes [BR:rce01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RC1_2081 (bchI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2138750..2139898
Genome map
AA seq 382 aa AA seqDB search
MDADSPGSVMERAPAVAATKGAAKRAPRGKRAEETPVAAPAEAPKRLPFPFSAIVGQEEM
KLALLIAAVDQSVGGVMVFGDRGTGKSTAVRALAALLPPMLAIDGCRYNCDPAKPCAECR
ARAADAPLHAKRVPVPVVDLPLGATEDRVVGALDLERALAKGEKAFEPGLLARAHRGFLY
IDEVNLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVLVGSGNPEEGELRPQLLDRF
GLSVEVKTPTVLQDRIEVVRRRDAFEHDPAAFCERWHKEEAALSRRIESARDHLSSVKVP
DTVLEHAAQLCMTLGADGLRGELTLMRAARALAALDGDAEVTDAHLRKVAPAALRHRLRR
NPLDEAGSSVRIERALQEMFGE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgactccccgggctccgtgatggagcgcgcccccgccgtcgccgcgacgaag
ggggccgccaagcgcgctccccgcggcaagcgggccgaggagacgccggtcgcggccccg
gccgaggcccccaagcgcctgcccttccccttctcagccatcgtcgggcaggaggagatg
aagctggcgctgctgatcgccgccgtggatcagagcgtcggcggcgtcatggtcttcggt
gaccgcggcaccggcaagtccacggccgtccgcgccctggccgccctgctgccgcccatg
ctggcgatcgacggctgccgctacaactgcgacccggccaagccctgcgccgaatgccgc
gcccgggcggcggacgcgccgctgcacgccaagcgcgtcccggtgccggtggtggacctg
ccgctgggcgccacggaggaccgcgtggtcggtgcgctggacctggagcgcgccctggcg
aaaggcgagaaggcgttcgagccgggcctgctggcccgcgcccaccgcggcttcctctac
atcgacgaggtgaacctgctggaggatcacctggtcgatctgctgctggacgtcgccgcc
tcgggcgagaacgtcgtcgagcgcgaggggctgagcatccgccatccggcccgcttcgtc
ctggtcggctccggcaatcccgaggagggcgagctgcggccgcagctcctggaccgcttc
ggcctgtcggtggaggtgaagaccccgaccgtgctgcaggaccggatcgaggtggtgcgc
cgccgcgacgcgttcgagcacgatcccgccgccttctgcgagcgctggcacaaggaagaa
gcggcgctgagccgccgcatcgaatccgcccgcgaccatctttcctcggtcaaggtgccg
gacacggtgctggagcatgccgcccagctctgcatgacgctgggggccgacggcctgcgc
ggcgagctgaccctgatgcgggctgcgcgggcgctggccgcgctggacggcgatgcggag
gtgacggacgcgcatctgcgcaaggtcgcccccgccgccctgcgccaccgcctgcggcgc
aacccgctggacgaggccggttcctccgtgcgcatcgagcgggcgttgcaggagatgttc
ggcgaatga

DBGET integrated database retrieval system