KEGG   Rhodospirillum centenum: RC1_2081Help
Entry
RC1_2081          CDS       T00785                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rce00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2138750..2139898
Genome map
AA seq 382 aa AA seqDB search
MDADSPGSVMERAPAVAATKGAAKRAPRGKRAEETPVAAPAEAPKRLPFPFSAIVGQEEM
KLALLIAAVDQSVGGVMVFGDRGTGKSTAVRALAALLPPMLAIDGCRYNCDPAKPCAECR
ARAADAPLHAKRVPVPVVDLPLGATEDRVVGALDLERALAKGEKAFEPGLLARAHRGFLY
IDEVNLLEDHLVDLLLDVAASGENVVEREGLSIRHPARFVLVGSGNPEEGELRPQLLDRF
GLSVEVKTPTVLQDRIEVVRRRDAFEHDPAAFCERWHKEEAALSRRIESARDHLSSVKVP
DTVLEHAAQLCMTLGADGLRGELTLMRAARALAALDGDAEVTDAHLRKVAPAALRHRLRR
NPLDEAGSSVRIERALQEMFGE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgactccccgggctccgtgatggagcgcgcccccgccgtcgccgcgacgaag
ggggccgccaagcgcgctccccgcggcaagcgggccgaggagacgccggtcgcggccccg
gccgaggcccccaagcgcctgcccttccccttctcagccatcgtcgggcaggaggagatg
aagctggcgctgctgatcgccgccgtggatcagagcgtcggcggcgtcatggtcttcggt
gaccgcggcaccggcaagtccacggccgtccgcgccctggccgccctgctgccgcccatg
ctggcgatcgacggctgccgctacaactgcgacccggccaagccctgcgccgaatgccgc
gcccgggcggcggacgcgccgctgcacgccaagcgcgtcccggtgccggtggtggacctg
ccgctgggcgccacggaggaccgcgtggtcggtgcgctggacctggagcgcgccctggcg
aaaggcgagaaggcgttcgagccgggcctgctggcccgcgcccaccgcggcttcctctac
atcgacgaggtgaacctgctggaggatcacctggtcgatctgctgctggacgtcgccgcc
tcgggcgagaacgtcgtcgagcgcgaggggctgagcatccgccatccggcccgcttcgtc
ctggtcggctccggcaatcccgaggagggcgagctgcggccgcagctcctggaccgcttc
ggcctgtcggtggaggtgaagaccccgaccgtgctgcaggaccggatcgaggtggtgcgc
cgccgcgacgcgttcgagcacgatcccgccgccttctgcgagcgctggcacaaggaagaa
gcggcgctgagccgccgcatcgaatccgcccgcgaccatctttcctcggtcaaggtgccg
gacacggtgctggagcatgccgcccagctctgcatgacgctgggggccgacggcctgcgc
ggcgagctgaccctgatgcgggctgcgcgggcgctggccgcgctggacggcgatgcggag
gtgacggacgcgcatctgcgcaaggtcgcccccgccgccctgcgccaccgcctgcggcgc
aacccgctggacgaggccggttcctccgtgcgcatcgagcgggcgttgcaggagatgttc
ggcgaatga

DBGET integrated database retrieval system