KEGG   Rhodospirillum centenum: RC1_2082Help
Entry
RC1_2082          CDS       T00785                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rce00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2139895..2141700
Genome map
AA seq 601 aa AA seqDB search
MSTDAARATPGADPRWVDAATAAALFAVDPVGTQGVAIRALAGPVRDRWLDLLRTLMPSG
APIRRMPLHVTDGNLLGGLDLAATLRAGRPVVGRGLLAEADGGAVVVAMAERLPPGTAAK
LAAVLDSGEVRMERDGIALSSRAALGIVALDEGIEEDERPPEALMDRLAFHIDLAGLPYR
EIDLTPVETDEVLEARALLPQVVLGPETVEAMCSTAMALGIDSVRAPLLALRVARAAAAL
AGRTAVGREEASIAARLVLAPRATMLPPSDEPQEEDEPPPPEEPDEPETPPDPPEQNEGD
ENKPLEDVVLEAAKAAIPAGLLAKLMAEGLSRSRSPQGGRAGATQTGGTRGRPAGVRRGE
PKAGTRLNVIETLRAAAPWQPLRRRAGGEGQTRVEVRKDDMRVNRIKRKSQTATIFVVDA
SGSAAFQRLAEAKGAVELLLADCYVRRDQVALLAFRGMEAELLLPPTRSLVRAKRSLAGL
PGGGGTPLAAGIDAAGALADALRRRGVTPTVVMLTDGRANVARDGGKGRQKGEQDALAAA
KQFRITGLTALVIDTSQRPDPAARQVAGEMGALYVPLPYADAAALSGVVRAAAPRPASQV
R
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggacgccgcccgcgcgactcccggtgccgatccgcgctgggtggacgcggcg
acggcagccgccctgttcgccgtcgatcccgtgggcacccagggcgtggccatccgcgcc
ctggcgggtccggtgcgcgaccgctggctggacctgctgcgcaccctgatgccgtccggc
gcaccgatccggcggatgccgctgcacgtcaccgacggcaacctgctgggcgggctggat
ctggccgcgaccctcagggccggccgccccgtcgtcggccgcggcctgctggccgaggcg
gacggcggcgccgtcgtcgtcgccatggccgagcggctgccgcccggcacggcggcgaag
ctggcggccgtgctcgattcgggcgaggtgcggatggagcgcgacggtatcgcgctgagc
agccgcgccgcgctgggcatcgtcgccctggacgaggggatcgaggaggacgagcgtccg
cccgaagccctgatggaccggctggccttccacatcgacctggccggactgccctaccgc
gagatcgacctgacccctgtcgagaccgacgaggtgctggaggcgcgcgccctgctgccg
caggtcgtcctcggtcccgagacggtggaggcgatgtgctccacggccatggcgctgggc
atcgacagcgtgcgcgcgcccctgctggccctgcgcgtggcgcgggccgcggccgccctg
gccggccgtaccgccgtcgggcgggaggaggcgtccatcgccgcccggctggtgctggcg
ccgcgcgccaccatgctgccgccgtccgatgagccgcaggaggaggacgagcccccgccg
ccggaggagccggacgagcccgagaccccgcccgatccgcccgaacagaacgagggcgac
gagaacaagcccctggaggacgtggtgctggaggcggccaaggccgccatccccgccggg
ctgctggcgaagctgatggccgaggggctgtcgcgctcccgctcgccccagggcggccgg
gccggcgccacccagaccggcggcacccgcggccgcccggccggcgtgcgccggggcgag
cccaaggccggcacccggctgaacgtgatcgagaccctgcgcgccgccgccccctggcag
ccgctgcgccgccgcgccggcggcgagggccagacccgggtcgaggtccgcaaggacgac
atgcgggtcaaccgcatcaaacggaagtcgcagacggcgaccatcttcgtcgtcgatgcc
tccggttccgccgccttccagcggctggccgaggcgaagggcgcggtcgagctgctgctg
gcggactgctacgtgcgccgcgaccaggtggcgctgctggccttccgtggcatggaggcg
gagctgctgctgccgcccacccggtcgctggtgcgcgccaagcgcagcctggccgggctg
ccgggcggcggcggcacgccgctggccgccggcattgacgccgccggcgccctggccgac
gcgctgcgccggcggggcgtcacgcccaccgtggtgatgctgaccgacggtcgcgccaac
gtggcgcgcgacggcggcaagggccggcagaagggcgagcaggatgcgctggcggcggcg
aagcagttccgcatcacggggctgacggcgctggtgatcgacacctcgcagcgccccgac
ccggcggcgcggcaggtggcgggggagatgggggcgctctacgtgcccctcccctatgcc
gacgcggcggccctgtcgggcgtcgtgcgggcggcggctccccgcccggcctcgcaggtc
cggtga

DBGET integrated database retrieval system