KEGG   Rhodospirillum centenum: RC1_2102Help
Entry
RC1_2102          CDS       T00785                                 

Gene name
c552
Definition
cytochrome c2 iso-2 (c552)
Orthology
K08738  
cytochrome c
Organism
rce  Rhodospirillum centenum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RC1_2102 (c552)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RC1_2102 (c552)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2161694..2162125
Genome map
AA seq 143 aa AA seqDB search
MKAFVAAAILAGTVLGATPALAQDGDPAKGEAVFKKCMACHRVGPDAKNLVGPALTGVID
RQAGTAPGFNYSAINHAAGEAGLHWTPENIIAYLPDPNAFLRKFLADAGHAEQAKGSTKM
VFKLPDEQERKDVVAYLKQFSPQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttcgtcgccgccgcgattctcgcgggaaccgtcctcggcgccaccccggcg
ctggctcaggatggcgatcccgcgaagggcgaagccgtgttcaagaagtgcatggcgtgc
caccgcgtcggccccgatgccaagaacctggtcggcccggccctcacgggtgtcatcgac
cgccaggccggcacggcccccggcttcaactactcggccatcaaccatgcggccggcgaa
gccgggctgcactggacgcccgagaacatcatcgcctacctgcccgatccgaacgccttc
ctgcgcaagttcctggccgatgccggccatgccgaacaggccaagggctccacgaagatg
gtcttcaagctcccggacgagcaggagcgcaaggacgtggtcgcctacctgaagcagttc
tccccccagtaa

DBGET integrated database retrieval system