KEGG   Rhodospirillum centenum: RC1_2125Help
Entry
RC1_2125          CDS       T00785                                 

Gene name
cheB3
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rce  Rhodospirillum centenum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rce00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RC1_2125 (cheB3)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RC1_2125 (cheB3)
Enzymes [BR:rce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RC1_2125 (cheB3)
Two-component system [BR:rce02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RC1_2125 (cheB3)
Bacterial motility proteins [BR:rce02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RC1_2125 (cheB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2192464..2193540)
Genome map
AA seq 358 aa AA seqDB search
MKKTRVLIVEDSPTVRLVLESIVTADPRLALAGSVRSAEQMLDVLEETDPDVISLDIRLP
GMSGLDATLEVMRRRPTPIVVVAADVNAEDGRLAMNALRAGALSVMEKPVGLGHAAYATV
ASRLCEQLVLMSKVKVVRQIAWPGRPAVRTDLPPPAGPAEPLARPDGFAVLAVVASTGGP
AALVQLLTGLGSDFPLPVLAVQHIGPGFVAGFADWLRSQTPFAVRIAADGEEPRPGTVHL
PPPDCHLLLKGGRLELSGADPVAGQRPSGTEMLRSVAAAAGRQGIGAVLTGMGSDGAEGL
RELSRAGGYTIAEDAATAVVYGMPAAAVDLGAVKALLPLPAIAPHILTLLARTGRTGA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacacgggtactgatcgtcgaggactcgccgacggtccgtctggtgctggag
agcatcgtgacggcagacccccggcttgcgctcgccgggtccgtccgctccgcggagcag
atgctcgacgtgctggaggagacggacccggacgtcatctccctcgacatccgcctgccc
gggatgagcggcctggacgccacgctggaggtgatgcggcggcggccgaccccgatcgtc
gtggtggcggccgacgtgaatgccgaggacgggcgcctcgccatgaacgcgctgcgcgcc
ggtgccctgtccgtgatggaaaagccggtgggtctgggccatgcggcctatgccaccgtc
gccagccggctgtgcgaacagcttgtcctgatgagcaaggtgaaggtcgtgcgccagatc
gcctggcccggccggcccgcggtgcggaccgatctgccgcccccggccggcccggcggag
ccgctggcgcgaccggacggcttcgcggtcctggccgttgtcgcctccaccggcgggccg
gcggcgctggtgcagctcctgaccgggctggggtccgactttccgctgccggtgctggcg
gtgcagcatatcggtcccggcttcgtcgccggctttgccgactggctgcgcagccagacg
cccttcgccgtccggatcgccgcggacggcgaggagccgcgccccggcaccgtccacctg
ccgccccccgactgccacctgctgctgaagggcggccggctggaactgtcgggggccgat
ccggtggccggacagcgcccctccggtaccgagatgctgcggtcggtcgccgccgcggcg
ggacgccagggcatcggcgccgtgctgaccgggatgggcagcgacggggccgaggggctg
cgcgagctgagccgtgccggcggctacaccatcgccgaggatgccgccaccgccgtcgtc
tacggcatgcccgcggcggccgtggacctgggggcggtgaaggcgctgctgccgctgccg
gccatcgccccccatatcctgaccctgctggcgcggacggggaggaccggagcatga

DBGET integrated database retrieval system