KEGG   Rhodospirillum centenum: RC1_2263Help
Entry
RC1_2263          CDS       T00785                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rce  Rhodospirillum centenum
Pathway
rce00020  Citrate cycle (TCA cycle)
rce00310  Lysine degradation
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
Module
rce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rce_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RC1_2263 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RC1_2263 (sucB)
Enzymes [BR:rce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RC1_2263 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H DUF3281 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ACI99650
UniProt: B6IPE8
Position
complement(2332883..2334115)
Genome map
AA seq 410 aa AA seqDB search
MATEIKVPTLGESVTEATVARWMKKVGDTVEADEPLVELETDKVTLEVNAPAGGTLTDIQ
AEDGATVGVGALLGVIADGAAKPAAAPAAAPAQAAPQPAAAPAAAAAGVMPAARKMADDH
GVDAGKIAGTGKDGRVTKGDVIQHLEQPRPAAAPAPAPTAPAAPAAKPAAPSGPRPRADL
EERVRMTRLRQRIAERLKEAQDTAAMLTTFNEVDMTNVIAMRARLKDAFEKKHGVKLGFM
SFFVKACIVALKEIPAVNAEIDGSDLVYKNYYDIGVAVGTPQGLVVPVVRDADRLGFAGV
EAKIAELGKKARDGKLSIEDLSGGTFTISNGGVYGSLMSTPILNPPQSGILGMHKTMDRA
VVVDGKVEVRPMMYLALSYDHRIIDGREAVTFLVRVKECIENPERILLDV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaaatcaaggttcccaccctcggcgaatcggtcacggaagccaccgtggcc
cgctggatgaagaaggtcggcgacacggtagaggccgacgagccgctggtggagcttgag
accgacaaggtgacgctggaggtgaacgcccccgccggcggcaccctgaccgacatccag
gcggaggacggcgccaccgtcggcgtcggtgcccttctcggcgtgatcgcggacggcgcg
gcgaagcccgccgcggctccggccgccgccccggcgcaggcggccccgcagcccgcggct
gcccctgccgccgctgcggcgggcgtcatgccggccgcgcgcaagatggcggacgatcac
ggcgtcgatgccgggaagatcgccggcaccggcaaggacgggcgcgtcaccaagggcgac
gtgatccagcatctggagcagccccgtccggcggccgccccggctcctgcgcccaccgcc
cccgcagccccggcggcgaagccggccgcgcccagcggtccgcgcccgcgtgccgacctg
gaggagcgggtgcgcatgacgcgcctgcgccagcgcatcgccgagcgcctgaaggaggcg
caggacaccgcggccatgctgaccaccttcaacgaggtggacatgaccaacgtgatcgcc
atgcgcgcccggttgaaggacgccttcgagaagaagcacggcgtgaagctgggcttcatg
tccttcttcgtgaaggcctgcatcgtggcgctgaaggagatcccggccgtgaatgccgag
atcgacggcagcgatctggtctacaagaactactacgacatcggcgtcgccgtgggcacg
ccgcaggggctggtcgtgccggtcgtgcgcgatgccgacaggctgggcttcgccggggtc
gaggcgaagatcgccgaactggggaagaaggcgcgcgacggcaagctctccatcgaggac
ctgtcgggcggcaccttcaccatctccaacggcggcgtgtacggctcgctgatgtccacg
ccgatcctcaacccgccgcagtccggcatcctgggcatgcacaagaccatggaccgcgcc
gtcgtggtggacggcaaggtcgaggtgcggccgatgatgtatctcgccctgtcctacgac
caccgcatcatcgacgggcgcgaggccgtcaccttcctggtgcgggtcaaggagtgcatc
gagaaccccgaacgcatcctgctggatgtctga

DBGET integrated database retrieval system