KEGG   Rhodospirillum centenum: RC1_2274Help
Entry
RC1_2274          CDS       T00785                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rce  Rhodospirillum centenum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RC1_2274 (deoA)
Enzymes [BR:rce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RC1_2274 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2348836..2350182)
Genome map
AA seq 448 aa AA seqDB search
MSGGQPFLPQEIIRKKRDGGTLADAEIAAFVAGLTDGSVGDGQAAAFAMAVLFRGLDGAE
RVALTRAMTRSGTVLDWTGERLPGPVLDKHSTGGVGDKVSLVLAPVIAACGGFVPMVSGR
GLGHTGGTLDKMDAIPGYVSQPDLARLRGVVREAGCAIVGATGDIAPADRRLYAIRDVTA
TVESLDLIVASILSKKLAAGLQGLVMDVKTGSGAFMPERERADALARAIVSVAEGAELPT
VALLTDMDQVLGATAGNAVELREAIAMLRGERGDSRLREVTRELCAEMLLLGGLAATLPE
ARARVEEALAGGAAAERFARMVALLGGPADLLERPERHLPEAPVTVDVHAAEDGYVAGQD
VRGLGLVVVALGGGRTRPTDGVDHRVGLTGVAAVGTQVGPGGTPLCRLHAADAETAAALA
DRVRAAFHLDSAPPAPTPVLLGRVSERA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcggacagcctttcctcccccaggagatcatccgcaagaagcgcgacggcggc
acgctggccgatgccgagatcgcggccttcgtcgccggcctgacggacggcagcgtcggc
gacggacaggccgccgccttcgccatggccgtgctgttccgcggcctggacggggcggag
cgggtggcgctgacccgcgccatgacccgctccggcacggtgctggactggaccggcgag
cggctgcccgggcctgtgctggacaagcattcgaccggcggcgtcggcgacaaggtgagc
ctcgtgctggcgccggtcatcgccgcctgcggcggcttcgtgcccatggtctcggggcgc
gggctgggccacaccggcggcacgctggacaagatggacgccatccccggctatgtcagc
cagccggacctcgcccgcctgcgcggcgtggtgcgggaggccggctgcgccatcgtcggc
gccaccggcgacatcgccccggccgaccgccggctctatgccatccgcgacgtcacggcg
acggtggagagcctggacctgatcgtcgcctccatcctctccaagaagctggcggccggg
ctccagggcctggtgatggacgtgaagaccggctccggcgccttcatgcccgagcgcgag
cgggccgacgccctggcccgggccatcgtctcggtggcggaaggggcggagctgcccacc
gtggcgctgctgacggacatggaccaggtgctgggtgcgacggccgggaatgcggtcgaa
ctgcgcgaggccatcgccatgctgcgcggcgagcgcggcgattcccgcctgcgcgaggtg
acgcgggaactgtgtgcggagatgctgctgctgggcgggctggccgcgaccctgccggag
gcgcgggcgcgggtggaggaggcgctggccggcggggcggcggccgagcggttcgcccgc
atggtggcgctgctgggcggccccgccgacctgctggagcggccggagcgccatctgccc
gaagctcccgtgacggtcgatgtccacgccgcggaggacggctatgtcgccggccaggac
gtgcgcgggctggggctcgtggtggtggcgctgggcggcggccggacccggccgaccgac
ggcgtggaccaccgcgtcggcctgaccggggtggccgccgtcggcacgcaggtcgggccg
ggcggcaccccgctgtgccggctgcacgccgcggacgcggagacggcggcggccctggcc
gaccgggtgcgcgccgccttccacctggacagcgccccgccggcgccgacgcccgtgctg
ctgggccgggtctccgagcgggcatag

DBGET integrated database retrieval system