KEGG   Rhodospirillum centenum: RC1_2686Help
Entry
RC1_2686          CDS       T00785                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rce  Rhodospirillum centenum
Pathway
rce00630  Glyoxylate and dicarboxylate metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01200  Carbon metabolism
Module
rce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_2686 (aceA)
Enzymes [BR:rce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RC1_2686 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACJ00061
UniProt: B6IUX9
Position
2761078..2762373
Genome map
AA seq 431 aa AA seqDB search
MMSPLDHGAPAKADLEAIHAKRWDGIKRDYTMEDVRRLSGSVKIEYTLAEMGARRLWELL
HTRPYVHTLGAFTGNQAVQHVKAGLEAIYLSGWQVAADANLAGQMYPDQSLYPANSVPAV
VKRINNALQRADQIQTAEGKGDTHWFAPIIADAEAGFGGPLNAFELMKAMIEAGAAGVHF
EDQLASEKKCGHLGGKVLIPIQQFIRTLNAARLGADVCGTSTLVIARTDAESAQLITSDV
DERDHPFIDRNDRTPEGFFRIKKGVGVDYCIARALEYAPYSDLMWWETSKPNLDDARRFA
EAVHKKFPGKMLAYNCSPSFNWKANLDDATIAKYQAELGAMGYKYQFVTLAGFHSLNLAT
FELAKGYKERGMAAYSEMQQREFAAVEKGFTAVKHQREVGTGYFDQVSLAISGGLSSTTA
MKDSTETDQFH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcaccgctcgaccacggcgcccccgccaaggccgaccttgaggcgatccacgcg
aagcgctgggacggcatcaagcgcgactacacgatggaggacgtccgtcgcctgtcgggc
tccgtcaagatcgagtacaccctggccgagatgggtgcgcgccgcctgtgggagctgctg
cacacccgcccctatgtccatacgctgggcgccttcaccggcaatcaggcggtgcagcat
gtgaaggccggcctggaagccatctacctgtccggctggcaggtcgccgccgacgccaat
ctggccggccagatgtatcccgaccagagcctctatccggccaactcggtcccggcggtg
gtcaagcgcatcaacaacgcgctgcagcgtgccgaccagatccagacggccgagggcaag
ggcgacacccactggttcgcgccgatcatcgccgacgccgaggccggcttcggcggcccg
ctgaacgccttcgagctgatgaaggcgatgatcgaggcgggcgccgccggcgtccacttc
gaggaccagctcgcgtcggaaaagaagtgcggccatctgggcggcaaggtgctgatcccg
atccagcagttcatccgcacgctgaacgccgcccgcctgggcgcggatgtctgcggcacc
agcacgctggtgatcgcccgcaccgacgccgagtcggcgcagctcatcacctccgacgtg
gatgagcgcgaccatcccttcatcgaccgcaacgaccgcacgccggaaggcttcttccgg
atcaagaagggcgtgggcgtcgattactgcatcgcccgcgcgctggagtacgcgccctat
tccgacctgatgtggtgggagacgtccaagccgaacctggacgacgcccgccgcttcgcg
gaggccgtccacaagaagttccccggcaagatgctggcctacaactgctcgccctccttc
aactggaaggccaacctggacgacgcgaccatcgccaagtaccaggctgagctgggcgcc
atgggctacaagtaccagttcgtcacgctggccggcttccactcgctgaacctcgccacc
ttcgaactggcgaagggctacaaggagcgcggcatggccgcctactccgagatgcagcag
cgcgagttcgcggccgtggagaagggcttcaccgccgtgaagcaccagcgcgaggtcggc
accggctacttcgaccaggtcagcctggcgatctccggcggcctgtcctccaccaccgcc
atgaaggactcgaccgagaccgaccagttccactga

DBGET integrated database retrieval system