KEGG   Rhodospirillum centenum: RC1_2688Help
Entry
RC1_2688          CDS       T00785                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
rce  Rhodospirillum centenum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RC1_2688 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RC1_2688 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RC1_2688 (aceB)
Enzymes [BR:rce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RC1_2688 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2763192..2764796
Genome map
AA seq 534 aa AA seqDB search
MTTLPAGVTLKGAVQPGFEQILTPEAIAFVVELERRFGARRLELLAAREARQARLDRGEK
PDFLAETADVRAGDWTIAPLPQDLQDRRVEITGPVDRKMIINALNSGARLFMADFEDSNT
PTWANQIEGQINLRDAVRRTIEFTDPASGKHYRLNEKPAVLKVRPRGWHLEERHLLVDGR
PISGGLFDFGLFFFHNAKELLARGSGPYFYLPKMEGHLEARLWNDAFTYAEQALGVPHGS
IKATVLIETILAAFEMDEILYELRDHSAGLNCGRWDYIFSFIKKFRTDPGAVLPDRAEVT
MATHMMNSYSLLAIKTCHRRNAPAIGGMAAFIPIKGDEEANRAAFAKVKADKEREASNGH
DGTWVAHPGLVPVALEVFDRLMPGPNQIARQRDDVTVTAADLLRVPDGHKTEAGLRMNVS
VSIGYLEAWLRGLGCVPLFNLMEDAATAEISRTQIWQWLHNGSALDDGRRVDRAMVETVI
AEELAAWKERVGADRYAAGKYEDAGRMLADLVFTDRFVEFLTLPAYERIVAEGA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgcccgccggcgtcaccttgaagggcgccgtgcagcccggcttcgagcag
atcctgacccccgaggcgatcgccttcgtggtcgagcttgagcgccgtttcggggcccgc
cggcttgagctgctggccgcccgcgaggcgcggcaggcgcggctggaccgcggcgaaaag
ccggacttcctggcggagacggcggacgtgcgcgccggcgactggaccatcgcgccgctg
ccgcaggacctccaggaccgccgggtggagatcaccggcccggtggaccgcaagatgatc
atcaacgccctgaacagcggcgcgcgcctgttcatggcggacttcgaggacagcaacacc
ccgacctgggccaaccagatcgagggtcagatcaatctgcgcgacgccgtgcgccggacc
atcgagttcaccgatccggccagcggcaagcactaccggctgaacgagaagccggccgtg
ctgaaggtccggccgcgcggctggcacctggaggagcggcatctgctggtggacggcagg
ccgatctccggcggcctgttcgacttcggcctgttcttcttccacaacgccaaggagctg
ctggcccgcggcagcggcccctacttctacctgccgaagatggagggccatctggaggcg
cggctgtggaacgacgccttcacctacgccgagcaggcgctgggcgtgccgcacggctcg
atcaaggccaccgtgctgatcgagacgatcctggccgccttcgagatggacgagatcctg
tacgagctgcgcgaccactcggccggcctgaactgcgggcgctgggactacatcttcagc
ttcatcaagaagttccgcaccgaccccggcgccgtgctgccggaccgggcggaggtgacg
atggccacccacatgatgaacagctacagcctgctggccatcaagacctgccaccgccgc
aacgcgccggccatcggcggcatggccgccttcatcccgatcaagggcgacgaggaggcg
aacagggccgcctttgccaaggtgaaggcggacaaggagcgcgaggcgtccaacggccat
gacggcacctgggtcgcgcatccggggctggtcccggtggcgctggaggtgttcgaccgg
ctgatgccggggccgaaccagatcgcgcgccagcgcgacgacgtgacggtcaccgccgcc
gacctgctgcgcgtgcccgacgggcacaagaccgaggccgggctgcgcatgaacgtctcc
gtctccatcggctatctggaggcgtggctgcgcgggctgggctgcgtgccgctgttcaac
ctgatggaggacgcggccacggccgagatcagccgcacccagatctggcagtggctgcac
aacggctccgccctggacgacggccgcagggtggaccgggccatggtggagacggtcatc
gcggaggagctggccgcctggaaggagcgcgtcggcgccgaccgctatgccgccggcaag
tacgaggatgccgggcggatgctggccgatctggtcttcaccgaccgcttcgtggagttc
ctgaccctgccggcctatgagcgcatcgtcgccgaaggcgcgtga

DBGET integrated database retrieval system