KEGG   Rhodospirillum centenum: RC1_2829Help
Entry
RC1_2829          CDS       T00785                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rce  Rhodospirillum centenum
Pathway
rce00260  Glycine, serine and threonine metabolism
rce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01130  Biosynthesis of antibiotics
rce01230  Biosynthesis of amino acids
Module
rce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RC1_2829 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RC1_2829 (trpB)
Enzymes [BR:rce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RC1_2829 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACJ00201
UniProt: B6IV77
Position
2913185..2914399
Genome map
AA seq 404 aa AA seqDB search
MTQPLNTYRTGPDERGHFGQFGGRYVAETLMPLILDVERAYAEARQDPSFKAELSYYLTH
YVGRPSPLYYAERLTAELGGAKIYLKREELNHTGAHKINNCMGQILLAKRMGKRRIIAET
GAGQHGVATATVCALFGLPCVIYMGETDIARQQPNVFRMKLLGAEVRPAKSGARTLKDAM
NDAMRDWVTNVEDTFYIIGTVAGPHPYPAMVRDFQSIIGEEVREQMQQAEGRLPDSLVAC
VGGGSNAIGIFHPFLDEPSVRMVAVEAAGYGIETGQHAASLTGGRPGVLHGNRTYLLQDE
DGQIVEGHSISAGLDYPGIGPEHAWLHDVKRVEYVSATDQEALDAFKLLARTEGILPALE
PAHALAHVTRLAPTLPRDHLMVMNLSGRGDKDIFTVARHMGVSL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcccctgaacacctaccggaccggaccggacgagcgcgggcatttcggccag
ttcggcggccgctatgtggccgaaacgctgatgcccctgatcctggacgtcgagcgcgcc
tatgccgaggcccggcaggacccctccttcaaggcggaactgtcctactacctgacccat
tatgtcggccggcccagcccgctctactacgccgagcggctgacggcggagctgggcggc
gccaagatctatctgaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaac
tgcatgggccagatcctgctggccaagcgcatgggcaaacgccgcatcatcgccgagacc
ggcgccggccagcacggcgtggcgacggccacggtgtgcgccctgttcgggctgccctgc
gtcatctacatgggcgagaccgacatcgcgcggcagcagcccaacgtcttccgcatgaag
ctgctcggcgccgaggtgcgccctgcgaagtccggcgcccgcacgctcaaggacgccatg
aacgatgccatgcgcgactgggtgacgaacgtcgaggacaccttctacatcatcggcacg
gttgccggcccgcacccctatccggccatggtgcgcgacttccagtccatcatcggcgaa
gaggtgcgtgagcagatgcagcaggccgagggccggctgccggacagcctggtcgcctgc
gtcggcggcggctccaacgccatcggcatcttccaccccttcctggatgaacccagcgtc
cgcatggtggcggtcgaggcggcgggctacggcatcgagaccggccagcacgccgccagc
ctgaccggcggccggccgggcgtgctgcacggcaaccgcacctacctgctgcaggacgag
gacggccagatcgtcgagggtcacagcatctccgccgggctggactatcccggcatcggg
ccggagcatgcctggctgcacgacgtgaagcgcgtggagtacgtctccgccaccgaccag
gaggcgctggacgccttcaagctgctggcccgcacggagggcatcctgcccgcgctggag
ccggcgcacgcgctggcccacgtcacccgtctcgcgcccacgctgcccagggatcacctg
atggtgatgaatctgtcgggccggggcgacaaggacatcttcaccgtggcccgtcacatg
ggggtatcgctgtga

DBGET integrated database retrieval system