KEGG   Rhodospirillum centenum: RC1_2830Help
Entry
RC1_2830          CDS       T00785                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rce  Rhodospirillum centenum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RC1_2830 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RC1_2830 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RC1_2830 (trpA)
Enzymes [BR:rce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RC1_2830 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2914396..2915256
Genome map
AA seq 286 aa AA seqDB search
MSLATEIDAGTETFRIARRFARLRAEGRAGLVTFLTAGDPDHATSLALLKGLPAAGADLI
ELGMPFTDPMADGPAIQASSLRALTAGARMTRTLDLVRDFRRDDPDTPVILMGYYNPVFS
YGVDRFLADAREAGVDGLIVVDLPPEADDELCLPALKAGVSFVRLSTPTTDERRLPAVLA
HTSGFVYHVSITGITGAGSASEESVSAAVARLKRHTDLPVAVGFGITTPDQAAAIARVAD
AAVVGSAIVRRLEQTLDADGRATAATVPAVLDFVRTLAEGVRTARG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcgccaccgagatcgacgcgggcacggagaccttccgcatcgcccgccgcttc
gcccggctgcgggccgaaggccgggccggcctcgtcaccttcctcacggccggcgatccc
gaccatgcgaccagcctcgccctgctgaaggggctgccggcggccggggccgacctgatc
gaactgggcatgcccttcaccgacccgatggcggacggtcccgccatccaggccagctcg
ctgcgggcgctgacggccggggcgcggatgacccgcacgctggatctcgtgcgcgacttc
cgccgcgacgacccggacacgccggtgatcctgatgggctactacaaccccgtcttcagc
tacggcgtggaccgcttcctggccgacgcccgcgaggccggggtggacgggctgatcgtc
gtggatctgccgccggaggcggatgacgagctgtgcctgccggcgctgaaggccggcgtc
agcttcgtgcgcctgtccacgccgacgacggacgaacgccgcctgccggccgtgctcgcc
cacacctcgggcttcgtctaccacgtctccatcaccggcatcacgggtgcgggctcggcc
agcgaggagtcggtcagcgccgccgtcgcccggctgaagcgccacaccgacctgccggtc
gccgtcggcttcggcatcaccacgcccgaccaggccgccgccatcgcccgcgtggccgac
gccgccgtcgtcggcagcgccatcgtccggcggttggaacagacgctggacgccgacggc
cgcgccactgccgcgaccgtgccggccgtgctagacttcgtccgcaccctggccgagggg
gtgcgcaccgcccgggggtga

DBGET integrated database retrieval system