KEGG   Rhodospirillum centenum: RC1_3030Help
Entry
RC1_3030          CDS       T00785                                 

Definition
(GenBank) acetyl-CoA synthetase, putative
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rce  Rhodospirillum centenum
Pathway
rce00010  Glycolysis / Gluconeogenesis
rce00620  Pyruvate metabolism
rce00640  Propanoate metabolism
rce00680  Methane metabolism
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_3030
   00620 Pyruvate metabolism
    RC1_3030
   00640 Propanoate metabolism
    RC1_3030
  Energy metabolism
   00680 Methane metabolism
    RC1_3030
Enzymes [BR:rce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RC1_3030
Lipid biosynthesis proteins [BR:rce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RC1_3030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACJ00397
UniProt: B6IVS3
Position
3107981..3109684
Genome map
AA seq 567 aa AA seqDB search
MTDGTMKDGTGAFMAARDILLAAGTDYDRARREFRWPDTGPFNWALDYFDVIARDNPQPA
LRVVSEDGSEETVSYAEMAARSARTATWLRGLGVGRGDRILLMLPNIPPLWEVMLAAMKL
GAVVIPATTLLAGEELRDRVERGGARFVIVAAGQCDRFDDLPGVTRIAVGGAPSGWIAYE
ESRGAPAEFSPDGETRPDDPMLLYFTSGTTAKPKLVLHTHRSYPVGHLSTMYWIGLRPED
VHWNISSPGWAKHAWSNVFAPWNAQATVFVYNYARFQARAVLDVLVGHGVTTLCAPPTVW
RMLIQEDLKSWPVRLREVVGAGEPLNAEVIEQVRSAWGLTVRDGFGQTETTAQVGNSPGQ
PVKPGSMGRPLPGYDVVLLDADGNEAEEGEIALRLSPRPAGLMAGYQSAAGEPVQPPAGG
WYRTGDVASRDADGYLTYVGRADDVFKASDYRISPFELESALIEHPAVAEAAVVPSPDPV
RLAVPKAFLVLAAGYEPDADLARDIFRHIRATLPPYKRVRRIEFADLPKTISGKIRRVEL
RREEQGRADGDGRHPQEFWEEDFPDLR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgacagacggcaccatgaaagacggcaccggggccttcatggccgcgcgcgacatcctg
ctggcggccgggaccgactacgaccgggcgcggcgggagttccgctggcccgacaccggc
cccttcaactgggcgctggactatttcgacgtcatcgcgcgggacaacccgcagcccgcc
ctgcgcgtggtttccgaagacgggagcgaggagacggtcagttatgcggagatggcggcc
cggtccgcccgcaccgcgacctggctgcgcgggctgggtgtcggacggggggaccgcatc
ctgctgatgctgcccaacatcccgccgctgtgggaggtgatgctggccgccatgaagctg
ggggcggtggtgatcccggcgaccaccctgctggccggcgaggagctgcgcgaccgggtg
gagcgcggcggcgcccggttcgtcatcgtcgcggccggacagtgcgaccggttcgacgat
ctgcccggggtcacccgcatcgccgtcggcggcgccccgtccggctggatcgcctatgag
gagtcgcgcggcgcccccgccgagttctcaccggacggggagacgcggcccgacgacccg
atgctgctctacttcacctccggcaccacggcgaagcccaagctggtgctgcacacgcac
cgctcctatccggtcgggcatctctccaccatgtactggatcgggctgcggccggaggac
gtccactggaacatcagctcgcccggatgggcgaagcatgcctggagcaacgtcttcgcg
ccctggaacgcccaggcgacggtcttcgtctacaactacgcccggttccaggcgcgggca
gtgctggacgtgctggtcgggcacggcgtgacgacgctgtgcgccccgccgacggtctgg
cgcatgctgatccaggaggacctgaagtcctggcccgtgcgcctgcgcgaggtggtgggg
gcgggcgaaccgctgaacgccgaggtgatcgagcaggtgcgcagtgcctggggcctgacg
gtccgcgacggcttcggccagaccgagacgacggcccaggtgggcaacagccccggccag
ccggtgaagcccggcagcatgggccgccccctgcccggctacgatgtcgtgctgctggat
gccgacggcaacgaggcggaggagggcgagatcgccctgcggctgtccccccgcccggcg
gggctgatggccggataccagagtgcggcgggagagccggtgcagccgccggccggcggc
tggtaccggaccggcgatgtcgccagccgcgacgccgacggctatctgacctatgtcggc
cgggccgacgacgtgttcaaggcgagcgactaccgcatcagccccttcgagctggaatcg
gccctgatcgagcatccggccgtggccgaggccgccgtcgtgccgtcgcccgatcctgtc
cgccttgcggtgcccaaggcgttcctggtgctggccgccgggtacgaaccggacgccgat
cttgcgcgcgacatcttccgccacatccgggcgacgctgccgccctacaagcgggtccgg
cgcatagagttcgcggacctgcccaagaccatctccggcaagatccggagggtcgagctg
cgccgcgaggagcagggccgcgcagacggcgacgggcgccacccgcaggagttctgggag
gaggacttccccgatctgcgctga

DBGET integrated database retrieval system