KEGG   Rhodospirillum centenum: RC1_3054Help
Entry
RC1_3054          CDS       T00785                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rce  Rhodospirillum centenum
Pathway
rce00071  Fatty acid degradation
rce00280  Valine, leucine and isoleucine degradation
rce00281  Geraniol degradation
rce00310  Lysine degradation
rce00360  Phenylalanine metabolism
rce00362  Benzoate degradation
rce00380  Tryptophan metabolism
rce00410  beta-Alanine metabolism
rce00627  Aminobenzoate degradation
rce00640  Propanoate metabolism
rce00650  Butanoate metabolism
rce00903  Limonene and pinene degradation
rce00930  Caprolactam degradation
rce01100  Metabolic pathways
rce01110  Biosynthesis of secondary metabolites
rce01120  Microbial metabolism in diverse environments
rce01130  Biosynthesis of antibiotics
rce01212  Fatty acid metabolism
Module
rce_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RC1_3054
   00650 Butanoate metabolism
    RC1_3054
  Lipid metabolism
   00071 Fatty acid degradation
    RC1_3054
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RC1_3054
   00310 Lysine degradation
    RC1_3054
   00360 Phenylalanine metabolism
    RC1_3054
   00380 Tryptophan metabolism
    RC1_3054
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RC1_3054
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RC1_3054
   00281 Geraniol degradation
    RC1_3054
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RC1_3054
   00627 Aminobenzoate degradation
    RC1_3054
   00930 Caprolactam degradation
    RC1_3054
Enzymes [BR:rce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RC1_3054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Titin_Z
Motif
Other DBs
NCBI-ProteinID: ACJ00420
UniProt: B6IVU6
Position
3125896..3126672
Genome map
AA seq 258 aa AA seqDB search
MPYENIQVETRGRVGLVRLNRPKALNALSDGLVTDLQAALDAFEDDPEIHVIVVTGSEKA
FAAGADIKEMADKSHMDAYLGDFITRKWGRLGTCRKPTIAAVAGYALGGGCELAMMADII
IAADTAKFGQPEITIGTIPGSGGTQRLTRLVGKSKAMLMCLTGWQMTAEEAERAGLVAKV
VPAADLLDETLKIADRIASMSLPVAMMTKECVNRSYESTLAEGILFERRVFHSTFGLEDR
KEGMSAFVEKRQPNFRDR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgagaacatccaggtggagacgcggggccgcgtcggccttgtccggctgaac
cgccccaaggcgctgaacgccctgtccgacgggctggtcaccgacctccaggcggcgctg
gacgccttcgaggacgatccggagatccatgtcatcgtcgtcaccgggtcggagaaggcc
ttcgcggccggcgccgacatcaaggagatggcggacaagtcgcacatggatgcctatctg
ggcgacttcatcacccgcaaatggggccggctgggcacctgccgcaagccgaccatcgcc
gccgtcgccggctatgccctgggcggcggctgcgaactggcgatgatggcggacatcatc
atcgccgccgacaccgcgaagttcggccagccggagatcaccatcggcaccatcccgggc
tccggcggcacgcagcgcctgacccggctggtgggcaagtccaaggccatgctgatgtgc
ctgaccggctggcagatgacggcggaggaggcggagcgcgccggactcgtcgccaaggtg
gtgccggccgccgacctgctggacgagacgctgaagatcgccgaccgcatcgcgtcgatg
tcgctgcccgtggcgatgatgaccaaggaatgcgtcaaccgctcctatgaatcgaccctg
gccgagggtatcctgttcgagcggcgggtcttccattccaccttcgggctggaggaccgg
aaagaggggatgagcgccttcgtcgagaagcgccagcccaacttccgcgaccgctga

DBGET integrated database retrieval system