KEGG   Rhodospirillum centenum: RC1_3088Help
Entry
RC1_3088          CDS       T00785                                 

Definition
(GenBank) GDSL-like Lipase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rce  Rhodospirillum centenum
Pathway
rce01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RC1_3088
Enzymes [BR:rce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RC1_3088
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RC1_3088
Lipid biosynthesis proteins [BR:rce01004]
 Fatty acid synthase
  Component type
   RC1_3088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK
Motif
Other DBs
NCBI-ProteinID: ACJ00453
UniProt: B6IVX9
Position
3166329..3167132
Genome map
AA seq 267 aa AA seqDB search
MSLSRSAETDSRYGFRRRLFNAKLVRAALVRAALVRGGLAVLAVWLLLAGPPAAAAPAPA
TLVVLGDSLSAGYGLPREAAFTSRLEAALTARGYDVRVPDTGVSGETTAGGLSRLDWILA
DRPTLVLVALGGNDGLRGIDPAATRANLDAILTKLAERGVPAVLAGMLAPRNLGRPYAEA
FDALFPELARRHAVPFYPFFLEGVAMRPELNLEDGMHPNAEGVAVMVAGILPTVTAALER
AGVVPEGGGGPEGGPAPAGAAEGRTAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctctcgcagcgcggaaacagacagccgatatggcttccgacgccggcttttc
aacgcaaagctcgtcagggcagcgctcgtcagggcagcgctcgtccggggcggcctcgcc
gtgctggccgtctggctgctgctggccggcccgcccgccgcggcggctccggctcccgct
accctcgtcgtgctgggcgacagcctgtccgccggctatggcctgccgcgggaggctgcc
ttcaccagccggttggaggccgcgctgacggcgcggggctacgacgtccgggtgccggat
accggcgtctccggcgagacgacggccggcgggctgtcccggctggactggatcctggcc
gaccggccgaccctggtgctggtggcgctgggcggcaatgacgggctgcgcggcatcgac
cccgccgccacccgcgccaacctggacgccatcctgacgaaactggccgagcgcggcgtg
cccgccgtgctggccgggatgctggccccgcgcaacctgggccgcccctatgccgaggcg
ttcgacgccctgttccccgagcttgcccgcaggcacgccgtgcccttctatccgttcttc
ctggagggcgtggcgatgcggccggagctgaacctggaggacggcatgcaccccaatgcc
gagggcgtggcggtgatggtggcgggcatcctgccgaccgtgaccgcggccctggagcgc
gccggggtggtgccggagggcggcggcggtcccgagggcggtcccgctcccgccggggct
gcggaggggaggacggcgccatga

DBGET integrated database retrieval system