KEGG   Rhodospirillum centenum: RC1_3404Help
Entry
RC1_3404          CDS       T00785                                 

Gene name
cycM
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rce  Rhodospirillum centenum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RC1_3404 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RC1_3404 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3512854..3513456)
Genome map
AA seq 200 aa AA seqDB search
MAGSDLNRIMMAVLGAILLAMMCGFIADQIVKPKQLAENAYKVTLPETAAAPAESTPGAT
ASGTGAADAAPAAAGGQEAGGPEPIAPLLAAADPQAGQKASRPCLACHTFEKGGPTRVGP
NLWNIVNASHAHMEGFAYSDAMKALQGKPWDYEALNRFLADPRGTVPGTKMIFAGIKNQK
DRADLIAWLRTLSDEPAPLP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaagcgacctcaacaggatcatgatggcggtgctgggagcgatcctgctcgcc
atgatgtgcggcttcatcgccgaccagatcgtgaagcccaagcagcttgcggagaacgcc
tacaaggtgacgctgcccgagacggcggcagccccggcggaaagcaccccgggcgcgacc
gcgtccggcaccggggcagccgatgccgcccccgccgcggcgggcggacaggaggcgggc
gggcccgaaccgatcgcgccgctgctggccgccgccgatccccaggcgggccagaaggcg
agccggccctgcctggcctgccacaccttcgagaagggcggccccacccgggtcgggccg
aacctctggaacatcgtcaatgcctcgcacgcgcacatggagggcttcgcctattccgac
gccatgaaggcattgcaggggaagccgtgggactatgaggcgctgaaccgcttcctggcc
gacccgcggggaaccgtgccgggaaccaagatgatcttcgccggcatcaagaaccagaag
gaccgcgccgacctgatcgcctggctgcgcacgctgtcggacgagccggcgcccctgccc
tga

DBGET integrated database retrieval system