KEGG   Rhodospirillum centenum: RC1_3404Help
Entry
RC1_3404          CDS       T00785                                 

Gene name
cycM
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rce  Rhodospirillum centenum
Pathway
rce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rce00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RC1_3404 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Neuropep_like Etmic-2 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACJ00764
UniProt: B6IWU0
Position
complement(3512854..3513456)
Genome map
AA seq 200 aa AA seqDB search
MAGSDLNRIMMAVLGAILLAMMCGFIADQIVKPKQLAENAYKVTLPETAAAPAESTPGAT
ASGTGAADAAPAAAGGQEAGGPEPIAPLLAAADPQAGQKASRPCLACHTFEKGGPTRVGP
NLWNIVNASHAHMEGFAYSDAMKALQGKPWDYEALNRFLADPRGTVPGTKMIFAGIKNQK
DRADLIAWLRTLSDEPAPLP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaagcgacctcaacaggatcatgatggcggtgctgggagcgatcctgctcgcc
atgatgtgcggcttcatcgccgaccagatcgtgaagcccaagcagcttgcggagaacgcc
tacaaggtgacgctgcccgagacggcggcagccccggcggaaagcaccccgggcgcgacc
gcgtccggcaccggggcagccgatgccgcccccgccgcggcgggcggacaggaggcgggc
gggcccgaaccgatcgcgccgctgctggccgccgccgatccccaggcgggccagaaggcg
agccggccctgcctggcctgccacaccttcgagaagggcggccccacccgggtcgggccg
aacctctggaacatcgtcaatgcctcgcacgcgcacatggagggcttcgcctattccgac
gccatgaaggcattgcaggggaagccgtgggactatgaggcgctgaaccgcttcctggcc
gacccgcggggaaccgtgccgggaaccaagatgatcttcgccggcatcaagaaccagaag
gaccgcgccgacctgatcgcctggctgcgcacgctgtcggacgagccggcgcccctgccc
tga

DBGET integrated database retrieval system