KEGG   Rhodospirillum centenum: RC1_3514Help
Entry
RC1_3514          CDS       T00785                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rce  Rhodospirillum centenum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RC1_3514 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_3514 (glk)
   00052 Galactose metabolism
    RC1_3514 (glk)
   00500 Starch and sucrose metabolism
    RC1_3514 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RC1_3514 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RC1_3514 (glk)
   00524 Butirosin and neomycin biosynthesis
    RC1_3514 (glk)
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RC1_3514 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3627639..3628619)
Genome map
AA seq 326 aa AA seqDB search
MSPAAPDTGHPSPALIADIGATNARFALVLDGRVTAERTLRCADFPSPAEAAEHYLESAP
APLRPDRGAFAIASPVTGDLIRMTNLTWEFSISGVRRALGFDRLEVINDFTAAALAVPEL
AEDERVQVGDGTPLPGAPVAVIGPGTGLGVSALIPGPSGWTALATEGGHVTMAPVSDREG
QVLAELRKIYDHVSAERVVSGMGLQNLYSALMLLDGREPEPLDPADISARGLDRSDVYCH
EALETFCAMLGTVAGNLALSLGARGGLYVMGGIVPRLLPFFSHSRFRKRFVEKGRMRDYL
GPVPTYVVTHPYPAFLGLTARLKHTA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgccgcccccgataccggacatccctcgccggccctgatcgcggacatcggc
gccaccaacgcccgcttcgccctggtgctggacggccgcgtcacggcggaacgcaccctc
cggtgcgccgacttcccgtcccccgccgaagcggcggagcactatctggagtcggctccg
gccccgctgcggcccgaccgcggcgccttcgccatcgcctccccggtgacgggcgacctg
atccgcatgaccaacctgacctgggagttctccatctccggggtacggcgggcgctgggc
ttcgaccggctggaggtgatcaacgatttcacggcggcggccctcgccgtccccgaactg
gcggaggacgaacgggtgcaggtgggcgacggcaccccgctgcccggtgcccccgtcgcc
gtcatcgggccgggcaccggcctgggcgtctccgccctgatccccggcccgtcgggctgg
acggccctggcgacggagggcggtcatgtcaccatggccccggtcagcgaccgcgagggg
caggtgctggccgaactgcgcaagatctacgaccatgtctcggccgagcgcgtggtctcc
ggcatggggttgcagaacctctacagcgcgctgatgctgctggacgggcgcgagccggag
ccgctggatcctgccgacatctccgcccgcgggctggaccgcagcgacgtctactgccac
gaggcgctggagacgttctgcgccatgctgggaacggtggcgggaaacctggcgctgagc
ctgggggcgcgcggcgggctctatgtcatgggcgggatcgtgccccgcctgctgcccttc
ttcagccattcccggttccgcaagcggttcgtcgagaaggggcggatgcgggactatctg
gggccggtgccgacctatgtcgtcacccacccctacccggccttcctgggcctgaccgcc
cgcttgaagcacaccgcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system