KEGG   Rhodospirillum centenum: RC1_3828Help
Entry
RC1_3828          CDS       T00785                                 

Gene name
ccpA
Definition
di-heme cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rce  Rhodospirillum centenum
Brite
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RC1_3828 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4002846..4003883
Genome map
AA seq 345 aa AA seqDB search
MLRSLFLGVAFAALAIGPAAADPLLDEARSLFKPLPATAPAIKDNPATPEKVDLGRMLFF
EPRLSSSHLFSCNSCHNVATGGVDGLETSIGHGWAAGPRNAPTVLNAVNNVAQFWDGRAK
DLKTQAKGPIQAAVEMNSTPDRVLQVLTSMPEYKGLFAKAFPGEKEPVSFDNVAKAIEVF
EATLITPDSPFDRFLAGDTKAMTAQQKKGLALFMEKGCSACHNGVNVGGQDYFPFGVMEK
PGADVLPAGDKGRFQVTNTATDEYVFRSPTLRNVTLTAPYFHSGKVWDLREAVAVMGNVQ
LGTVLSEEEIDAITAFLGSLTGRQPRIEVPILPPSTPATPKPVTQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctccgatccctgttcctcggcgtcgccttcgccgccctcgccatcggcccggcggcg
gccgacccgctgctggacgaggcccgcagcctgttcaagccgctgcccgccacggctccg
gcgatcaaggacaaccccgccactccggagaaggtggacctcgggcgcatgctgttcttc
gaaccgcgtctgtcgtccagccatctgttctcctgcaactcctgccacaacgtggcgacc
ggcggcgtggacgggctggaaacctcgatcggtcacggctgggccgccggcccgcgcaat
gcccccaccgtgctgaacgccgtcaacaacgtggcgcagttctgggacggccgcgccaag
gatctgaagacccaggccaaggggccgatccaggcggcggtggagatgaacagcacgccc
gaccgggtgctccaggtcctgaccagcatgcccgaatacaaggggctgttcgccaaggcg
ttccccggcgagaaggagcccgtcagcttcgacaacgtggcaaaggccatcgaggtgttc
gaggcgacgctgatcacgccggactcgcccttcgaccgtttcctcgccggtgacaccaag
gcgatgacagcgcagcagaagaaggggctggccctgttcatggagaagggctgttcggcc
tgccacaacggcgtcaatgtcggtgggcaggactatttcccgttcggcgtcatggagaag
ccgggggcggacgtgctgccggccggcgacaagggccgcttccaggtcaccaacacggcg
accgacgaatatgtcttccgctcgccgaccctgcgcaacgtcaccctgacggcgccctac
ttccactcgggcaaggtctgggatctgcgcgaggcggtggctgtgatgggcaacgtccag
ctcggcaccgtgctgtcggaggaggagatcgacgccatcaccgccttcctcggctcgctc
accgggcgccagccgcggatcgaagtgccgatcctgccgcccagcacgccggcgacgccg
aagccggtcacgcagtga

DBGET integrated database retrieval system