KEGG   Rhodospirillum centenum: RC1_3878Help
Entry
RC1_3878          CDS       T00785                                 

Definition
chemotaxis protein methyltransferase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rce  Rhodospirillum centenum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rce02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rce02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4055274..4058258
Genome map
AA seq 994 aa AA seqDB search
MTTRRHPAPDLPTAAKAPEPRLRCGPAPVSLHGRPDFIVALGASAGGLEALQDFFSALDP
VQARPAAFIVVQHLSPDHKSMMPDLLTRSTCLPITVIEDGMPLVAGQVFLIPPSVTLRIT
PTGRFALRPKTPGVVSLPIDILFTSMAEVFKNNCIGVVLSGTGSDGTRGVVAINSVGGLT
LAQTPSSAQFDGMPRSAIATGYVDEQGDARQLARRVLEYLHGQVPEPVLLHAPDGVSGPE
QEGYRAILEDLSTRTAIPFDQYKQSTVVRRIHRRMTLRHCASLTDYAKLLRGDPAELQTL
RREVLIGVTRFFRDGPAFDELARLLPDLLAHKAKGEPLRIWSAGCSTGEEAYSLAILVHE
AMQAAGLSLEVKIFATDVVQDYLDVASAGLYPATIEAELSPQRLDACFVRQGEMYRITPA
IRRMVIFARHNVITDAPFTKVDLLVCRNTLIYFEASLQEKVIKRFQYALTDGGILFLGSS
ESLGPAARDFMVLSSKNKIFRTLRPGALSLEALQIGRMDRALHVVSRPPGVADPATPMDR
IKDALIDTLLPPSILLTETREIAHVFGDVSRFLRLPKGQATLDPARMMAPGASATLLQVL
AVARRDRAPVFSAPIALGRPADGPVEAFRIRAAPVAHEAPLDQLMVVTFLPVQAAAIVPD
PADAAEAPSARIEMLEGELAITREHLQSTIEELEAANEELQAANEELLASNEELQSTNEE
LQSVNEELYTVNSEYQEKIQLLVKANADLDLMARAAAIPTIFVDSEIVLTRFTPDSRLIY
DFRDTDIGRPLGDFSNKIGYATLPRDLGAVVQQRTGREVYWRTRDGTDYLIRMMPYSDGE
GAVLGAVVAFIDITKLNQLESLQNLIDSLPEHLAVLDGDGNIQFVNSAWTRFAAANEGDA
ERVGVGTNYFDACVGAVPRDSYAAKAAAGLRAVLSRSIEHFSLRYPCHSPTEKRWFLMHA
APLQGSGGGAVVSHINITSLVGANDEEEVLSHEA
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacgcgccgccaccccgcccccgatctcccgacggctgcaaaggcgccggagccc
cgtctccggtgcgggccggcgccggtctccctgcacggccggccggacttcatcgtcgcg
ctgggggcctcggccggcgggctggaggcgttgcaggatttcttctccgcgctcgacccg
gtgcaggcgcgcccggcggccttcatcgtcgtgcagcatctctcgcccgaccataagagc
atgatgccggacctgctgacccggagcacatgcctgccgatcaccgtgatcgaggacggc
atgccgctcgtggccgggcaggtcttcctgattccgccctcggtgacgctgcgcatcacg
ccgaccgggcgcttcgcgttgcgcccgaagacccccggcgtcgtcagcctgcccatcgac
atcctgttcacgtcgatggccgaggtgttcaagaacaactgcatcggggtcgtgctgtcc
ggcaccggcagcgacggcacgcgcggcgtggtggcgatcaacagcgtcggcggcctgacg
ctcgcgcagactccttcctcggcccagttcgacggcatgccccgcagcgccatcgccacc
ggctacgtggacgagcagggggatgcgcgacagctcgcccgccgcgtcctggaatacctg
cacggccaggtccccgaacccgtgctgctgcatgccccggacggggtgtccggccccgag
caggagggataccgcgcgatcctggaggatctgagcacccggaccgccattcccttcgac
cagtacaagcagtccaccgtcgtccgccgcatccaccgccggatgaccctccgccactgt
gccagcctgaccgactacgccaagctcctgcgcggcgatcccgcggagttgcagacgctg
cgccgtgaggttctgatcggcgtcacccggttcttccgcgacggtcccgccttcgacgag
ctggccaggctcctgcccgacctgctggcgcacaaggcgaagggcgaaccgctgcggatc
tggtcggccgggtgctccacaggggaagaagcctactccctggccatcctggtccatgag
gcgatgcaggcggcgggcctgagccttgaggtgaagatcttcgccaccgacgtggtgcag
gactatctcgacgtcgcctccgccgggctctatcccgcgaccatcgaggccgagctgtcg
ccgcagcggctggatgcctgtttcgtccgccagggggagatgtaccgcatcaccccggcg
atccggcgcatggtgatcttcgcccggcacaacgtcatcaccgacgcccccttcaccaag
gtcgatctgctggtctgccgcaacacgctgatctacttcgaggcgtccctccaggagaag
gtcatcaagcgcttccagtacgcgctgacggacggcggcatcctgttcctgggcagcagc
gagagcctgggacccgccgcgcgcgatttcatggtcctttcctccaagaacaagatcttc
cggaccttgcggccgggggccctgtcgctggaggcgttgcagatcgggcgcatggaccgg
gccctgcacgtcgtctcccggccgccgggcgtggcggacccggcgacgccgatggaccgg
atcaaggatgcgctgatcgacaccctcctgccgcccagcatcctgctgaccgaaacgcgg
gagatcgcgcatgtgttcggggatgtctcccgcttcctgcggctgccgaaggggcaggcg
accctggatcctgcccgcatgatggcgcccggcgccagcgccaccctgcttcaggtcctg
gcggtggccagacgggaccgtgcccccgtgttctctgccccgatcgccctcgggcgcccg
gcggacggccctgtcgaagccttccgcatccgggcggcgccggtggcgcacgaggcgccg
ctggaccagttgatggtcgtgaccttcctgcctgtgcaggcggcggccatcgttccggat
ccggccgacgctgcggaagcccccagcgcccgcatcgagatgctggaaggggaactggcg
atcacacgggaacaccttcagtctaccatcgaagaactggaggcggccaacgaggaactg
caggcggccaacgaggagcttctggcttccaacgaggaactgcaatcgacgaacgaggaa
ctgcagtcggtcaatgaggaactctatacggtcaacagcgagtatcaggagaagatccag
cttctggtgaaggcgaatgccgatctggacctgatggcgcgggcggcggcaatcccgacg
atcttcgtggattcggagatcgtcctgacccggttcacgccggattcccgcctgatctac
gatttccgcgataccgacatcggtcgcccgctcggggatttctcgaacaagatcggctat
gcgaccttgccgcgcgacctcggggcggtggtgcagcagcggaccggccgggaggtctac
tggcggacccgggacggcaccgactacctgatccgcatgatgccctattccgacggcgag
ggggccgtgctgggcgcggtcgtcgccttcatcgacatcaccaagctgaaccagcttgaa
agtctccagaacctcatcgattcactgcccgagcatctggccgtcctggatggcgacggg
aacatccagttcgtcaactccgcctggacccggttcgccgcagccaatgagggagacgcc
gagcgggtcggcgtcggcaccaactatttcgatgcctgcgtgggtgccgtgccccgcgac
agctacgctgccaaggcggcggccgggctgcgtgccgtgctcagccgcagcatcgagcat
ttctccctgcgctatccctgccattcaccgaccgagaagcgctggttcctgatgcatgcg
gctcccctgcaaggcagcgggggcggcgctgtggtcagccatatcaacatcacgtcgctg
gtcggtgcgaacgacgaggaggaggtcttgtcccatgaagcctga

DBGET integrated database retrieval system