KEGG   Rhodospirillum centenum: RC1_3912Help
Entry
RC1_3912          CDS       T00785                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rce  Rhodospirillum centenum
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RC1_3912 (nosZ)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RC1_3912 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4105466..4107394)
Genome map
AA seq 642 aa AA seqDB search
MDDSNEKTEGLNRRALLGGTAKAAALAGFGALGGAAVTAGGLVAPAPAAAASGRSVTEVK
PGDLDEYYVFHSGGHSGEIRIMGLPSMRELIRIPVFNRCSATGWGLTNESRKILTDGLLP
ETRRFLESRGGSYLNGDLHHPHMSFTDGTYDGRYIFCNDKANTRIARIRCDIMRADRIIE
IPNASAIHGLRLQKYPRTGYIFANGEQRVPTPNDGKGLTDTKRYRSHFTAVDGDTMKVAW
QVWVDGNLDNTEADYQGKYAFSTCYNSEEGVTLAEMTAKEQDWLVVFNLKRIEEAVRSGK
AQVINGVPVVDGRHGSPYTRYVPIPNSPHGVNMAPDGIHLTANGKLSPTVTVMDVRRFDD
LFDDRIKPRDVVVAEPQLGLGPLHTAYDGRGNAYTTLFLDSQVVKWNIDKARRAYTGENV
SPIVQKLDVHYQPGHLHSSMGQTREADGKWLITLNKFSKDRFLNVGPLKPENDQLIDISG
DEMKLVHDGPTFAEPHDTLIVHHSKVNPRSVYDRADPMWEDARRQAAADGVTLETDAKVI
RDGDKVRVYMYSNAPVFALDEFTVREGDEVTVYVTNIDDVDDLTHGFTLTNHGIAMEIGP
QQTSSVTFTADRPGVFWYYCQWFCHALHMEMGGRMIVEPKSA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggacgacagcaacgagaagaccgaagggctcaaccgacgcgccctgctgggcggcact
gcgaaggccgcggccctggccggcttcggcgccctgggcggtgccgccgtcaccgccggc
gggctggtcgccccggcaccggccgccgccgccagcggccgcagcgtcaccgaggtgaag
cccggcgacctggacgagtactacgtcttccattccggcggtcattcgggcgagatccgc
atcatgggcctgccctcgatgcgcgagctgatccgcatcccggtcttcaaccgctgcagc
gccaccggctggggcctgaccaacgaaagccggaagatcctgaccgacggcctgctgccg
gagacccgcaggttcctggagagccgcggcgggtcctacctgaacggcgacctgcaccac
ccgcacatgtcgttcacggacggcacctacgacggccgctacatcttctgcaacgacaag
gccaacacccgcatcgcgcgcatccgctgcgacatcatgcgggccgacaggatcatcgag
atccccaacgcctcggccatccacgggctgcggctgcagaagtacccgcgcaccggctac
atcttcgccaacggcgagcagcgcgtgccgacaccgaacgacggcaaggggctgacggac
accaagcgctaccgctcccacttcacggccgtggacggcgacaccatgaaggtggcctgg
caggtctgggtggacggcaacctggacaacacggaagccgactaccagggcaagtacgcc
ttctccacctgctacaattccgaggagggcgtcacgctggcggagatgacggccaaggag
caggactggctggtcgtcttcaacctcaagcgcatcgaggaagccgtccgcagcggcaag
gcccaggtcatcaacggcgtgccggtggtggacggccgccacggctccccctacacccgc
tacgtgccgatcccgaacagcccgcacggcgtcaacatggccccggacggcatccacctg
accgcgaacggcaagctgtcgccgaccgtgacggtgatggatgtccgccgtttcgacgat
ctgttcgatgacaggatcaagccgcgcgacgtggtggtggccgagccgcagctcgggctc
gggccgctccacaccgcctatgacggccgcggcaacgcctacaccaccctgttcctggac
agccaggtcgtgaagtggaacatcgacaaggccaggcgcgcctatacgggcgagaacgtc
tcccccatcgtgcagaagctggatgtccactaccagccggggcacctgcactcctccatg
ggtcagaccagggaggcggacggcaagtggctgatcaccttgaacaagttctccaaggac
cggttcctgaacgtcggtccgctgaagccggagaacgaccagctcatcgacatctccggc
gacgagatgaagctggtgcatgacggcccgaccttcgccgaaccgcacgacacgctgatc
gtgcatcattccaaggtcaatccgcgcagcgtctacgaccgcgccgacccgatgtgggag
gacgcgcgccggcaggcggcggcggacggggtgacgctggagacggacgccaaggtgatc
cgcgacggcgacaaggtgcgggtctacatgtactccaacgccccggtcttcgcgctggac
gagttcacggtgcgggaaggcgacgaggtcaccgtctacgtcaccaacatcgacgacgtg
gacgacctgacccacggtttcactctgaccaaccacggcatcgccatggagatcgggccg
cagcagacctcgtcggtgaccttcaccgccgaccggcccggcgtgttctggtactactgc
cagtggttctgccatgcgctgcacatggaaatgggcggccgcatgatcgtcgaaccgaag
agcgcctga

DBGET integrated database retrieval system