KEGG   Rhodospirillum centenum: RC1_3981Help
Entry
RC1_3981          CDS       T00785                                 

Definition
cytochrome c2 iso-1
Orthology
K08738  
cytochrome c
Organism
rce  Rhodospirillum centenum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RC1_3981
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RC1_3981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4185834..4186265)
Genome map
AA seq 143 aa AA seqDB search
MKKSFATLALSGLVALSASGALAQDGDPVKGEAVFKKCMACHRIGPDAKNLVGPVLTGVV
GRQAGVAPGFSYSALNHAAGEAGLHWTAENIMAYLPDPNAFLRKFVTDAGNPEAAKGSTK
MVFKLPNEQERKDVVAYLKTFSN
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagtcgttcgccaccctggccctgtccgggcttgtcgcgctttccgccagcggg
gcgctggctcaggatggcgatccggtcaagggcgaagccgtgttcaagaagtgcatggcc
tgccaccggatcggcccggatgccaagaacctcgtcggtccggtcctcaccggtgtcgtc
ggccgtcaggccggcgttgcgccggggttcagctattccgccctgaaccatgcggcgggt
gaagccggcctgcactggacggccgaaaacatcatggcctacctgccggacccgaacgcc
ttcctgcgcaagttcgtgaccgacgccggcaatccggaagcggccaagggctccacgaag
atggtcttcaagctcccgaacgagcaggagcgcaaggacgtcgtcgcctacctgaagacc
ttctccaactga

DBGET integrated database retrieval system