KEGG   Rhodospirillum centenum: RC1_4045Help
Entry
RC1_4045          CDS       T00785                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rce  Rhodospirillum centenum
Pathway
rce00480  Glutathione metabolism
rce00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RC1_4045 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RC1_4045 (gpo)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RC1_4045 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACJ01384
UniProt: B6IYL0
Position
complement(4265097..4265579)
Genome map
AA seq 160 aa AA seqDB search
MSEFHSLHARSLRGQDVPLSRFAGQVALVVNTASKCGFTPQYAGLEALYRKYADQGFVVL
GFPCNQFGNQEPGDAATIEGSCLVNYGVSFPMFEKVDVNGPQAHPVFRWLTTRLPGLFGQ
GIRWNFTKFLIGRDGRPLRRFAPMTKPEGIEAHVRAALGQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattccattccctgcacgcccgctcgctgcgcgggcaggatgtcccgctgtcc
cggttcgcgggccaggtcgcgctggtcgtgaacaccgccagcaagtgcggcttcaccccc
cagtatgcggggctggaggcgctctaccggaaatacgccgaccagggcttcgtcgtgctg
ggcttcccctgcaaccagttcggcaaccaggagccgggcgacgcggccaccatcgaggga
agctgccttgtcaattacggggtcagcttccccatgttcgagaaggtggacgtgaacggc
ccgcaggcgcatccggtgttccgctggctgaccacccggctgcccggcctgttcggacag
gggatcaggtggaacttcacgaagttcctgatcggccgcgacgggcgcccgctgcgccgc
ttcgccccgatgacgaagccggagggcatcgaggcgcatgtccgcgccgccctgggacag
tga

DBGET integrated database retrieval system