KEGG   Rhodospirillum centenum: RC1_4065Help
Entry
RC1_4065          CDS       T00785                                 

Gene name
cbbF
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  
fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
rce  Rhodospirillum centenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RC1_4065 (cbbF)
   00030 Pentose phosphate pathway
    RC1_4065 (cbbF)
   00051 Fructose and mannose metabolism
    RC1_4065 (cbbF)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_4065 (cbbF)
   00680 Methane metabolism
    RC1_4065 (cbbF)
Enzymes [BR:rce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     RC1_4065 (cbbF)
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC1_4065 (cbbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4286181..4287296
Genome map
AA seq 371 aa AA seqDB search
MPHRRTTFSRFIIEDQRRRGGSDTELTALLNDVQTACKFIATAVARGSLKQPYTPIGVET
VAAPGVNVHGEMQKPLDLIANEIFLRNCEFGGQVCGMASEEMEEPYVIPAQFPRGRYLLV
FDPLDGSSNLDVNVTVGTIFSILRAPEGVTEPTVEDFLQPGTQQVAAGFALYGPVDMIIT
TFGEGVHGFTLDREVGAYTLTHPNMRIPEKACEFAINASNERFWEPPVRRYVEECIEGKT
GPRGQDFNMRWVASLVAEVYRILIRGGLFMYPRDTRPSCKPGRLRLLYEANPIAMVVEQA
GGAASTGRQRILDIKPESLHQRVPLILGSKAEVERLDRYHAAYDRGEDLKFEAPLFGTRS
VFITPVSATQD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatcgtcgaacgacgttcagtcgcttcataatcgaagatcagcgccgccgcggt
ggcagcgataccgaactgaccgcgctgctgaacgacgtgcagaccgcctgcaagttcatt
gcgacggccgtcgcccggggctccctcaagcagccttacacccccatcggggtggaaacc
gtcgcggcgcccggcgtgaacgtccatggcgagatgcagaagccgctggacctcatcgcc
aacgagatcttcctgcggaactgcgagttcggcggccaggtctgcggcatggcctcggag
gagatggaggagccctacgtcattcccgcgcagttcccgcgcggccgctacctcctggtc
ttcgatccgctggacggttcctccaacctggacgtcaacgtcacggtcggcaccatcttc
tcgatcctgcgcgcgcccgagggcgtgaccgaaccgaccgtcgaggatttcctgcagccg
ggcacgcagcaggtggcggccggcttcgccctctacggcccggtggacatgatcatcacc
accttcggcgagggcgtgcacggcttcacgctggaccgcgaggtcggcgcctataccctg
acgcatccgaacatgcgcatccccgagaaggcgtgcgagttcgccatcaacgcctcgaac
gagcgtttctgggaaccgcccgtccgccgctacgtggaggagtgcatcgagggcaagacc
ggcccgcgcgggcaggacttcaacatgcgctgggtcgccagtctggtggcggaggtctac
cgcatcctgatccgcggcggcctgttcatgtacccgcgggatacccgcccgtcctgcaag
cccggccgtctccgcttgctctacgaggccaaccccatcgccatggtggtggaacaggcc
ggcggggccgccagcaccggacgtcagcgcatcctggacatcaagccggagagcctgcac
cagcgcgtgcccctgatcctcggctccaaggccgaggtggagcggctcgaccgctaccat
gcagcctacgaccggggggaggacctgaagttcgaggcgccgctgttcggcacccgctcg
gtcttcatcacccccgtttccgccacccaggattga

DBGET integrated database retrieval system