KEGG   Rhodospirillum centenum: RC1_4066Help
Entry
RC1_4066          CDS       T00785                                 

Gene name
cbbP
Definition
(GenBank) phosphoribulokinase I
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
rce  Rhodospirillum centenum
Pathway
rce00710  Carbon fixation in photosynthetic organisms
rce01100  Metabolic pathways
rce01120  Microbial metabolism in diverse environments
rce01200  Carbon metabolism
Module
rce_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rce_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rce_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_4066 (cbbP)
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     RC1_4066 (cbbP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK APS_kinase ABC_tran Zeta_toxin cobW AAA_16 AAA_22 KTI12 GARS_N ArgK
Motif
Other DBs
NCBI-ProteinID: ACJ01405
UniProt: B6IYN1
Position
4287319..4288194
Genome map
AA seq 291 aa AA seqDB search
MSVKHPIIAITGSSGAGTTTVTRTFQQIFRREGVTAAIVEGDSFHRYDRKEMRAKMKEAQ
ENNQPDFSHFGPEANLFEELEDLFRHYGETGQGRVRKYLHDDKEAEPYGQEPGTFTDWET
LPADTDILFYEGLHGCVKTDRVDVSRHVDLRIGVVPIVNLEWIQKIHRDRNMRGYSQEAV
VDTILRRMPDYVKYICPQFSLTDVNFQRVPTVDTSNPFVARDIPSSDESMLVIRFANPKG
IDFPYLLAMLKDSFMSRPNTIVCPGDKMALAMQLIFTPMIWQLMDRKKKAF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcaagcaccccatcatcgccatcaccggctcgtccggcgccgggacgaccacc
gtcacccgcaccttccagcagatcttccgccgtgagggcgtcaccgcggccatcgtcgag
ggtgacagcttccatcgctacgaccgcaaggagatgcgggcgaagatgaaggaagcgcag
gagaacaaccagcccgacttcagccatttcggccccgaggcgaacctgttcgaggagctg
gaggatctgttccgccactacggcgagacaggccagggccgtgtccgcaagtacctgcac
gacgacaaggaggccgagccctacggtcaggagcccggcaccttcaccgactgggagacc
ttgccggccgacaccgacatcctgttctacgagggcctgcacggctgcgtgaagaccgac
cgggttgacgtgtcccgccatgtcgatctcaggatcggcgtcgtgcccatcgtgaacctg
gagtggatccagaagatccaccgcgaccgcaacatgcgcggctattcgcaggaggccgtg
gtcgatacgatcctgcgccgcatgccggactatgtgaagtacatctgcccgcagttcagc
ctgacggacgtgaacttccagcgcgtgccgacggtggacaccagcaatcccttcgtcgcc
cgcgacattcccagctccgacgagagcatgctggtcatccgcttcgccaaccccaagggg
atcgacttcccctacctgctggcgatgctgaaggacagcttcatgtcccggcccaacacc
atcgtctgcccgggcgataagatggcgctggccatgcagttgatcttcacccccatgatc
tggcagctcatggatcgcaagaagaaggcgttctag

DBGET integrated database retrieval system