KEGG   Rhodospirillum centenum: RC1_4066Help
Entry
RC1_4066          CDS       T00785                                 

Gene name
cbbP
Definition
(GenBank) phosphoribulokinase I
  KO
K00855  
phosphoribulokinase [EC:2.7.1.19]
Organism
rce  Rhodospirillum centenum
Pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RC1_4066 (cbbP)
Enzymes [BR:rce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     RC1_4066 (cbbP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4287319..4288194
Genome map
AA seq 291 aa AA seqDB search
MSVKHPIIAITGSSGAGTTTVTRTFQQIFRREGVTAAIVEGDSFHRYDRKEMRAKMKEAQ
ENNQPDFSHFGPEANLFEELEDLFRHYGETGQGRVRKYLHDDKEAEPYGQEPGTFTDWET
LPADTDILFYEGLHGCVKTDRVDVSRHVDLRIGVVPIVNLEWIQKIHRDRNMRGYSQEAV
VDTILRRMPDYVKYICPQFSLTDVNFQRVPTVDTSNPFVARDIPSSDESMLVIRFANPKG
IDFPYLLAMLKDSFMSRPNTIVCPGDKMALAMQLIFTPMIWQLMDRKKKAF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcaagcaccccatcatcgccatcaccggctcgtccggcgccgggacgaccacc
gtcacccgcaccttccagcagatcttccgccgtgagggcgtcaccgcggccatcgtcgag
ggtgacagcttccatcgctacgaccgcaaggagatgcgggcgaagatgaaggaagcgcag
gagaacaaccagcccgacttcagccatttcggccccgaggcgaacctgttcgaggagctg
gaggatctgttccgccactacggcgagacaggccagggccgtgtccgcaagtacctgcac
gacgacaaggaggccgagccctacggtcaggagcccggcaccttcaccgactgggagacc
ttgccggccgacaccgacatcctgttctacgagggcctgcacggctgcgtgaagaccgac
cgggttgacgtgtcccgccatgtcgatctcaggatcggcgtcgtgcccatcgtgaacctg
gagtggatccagaagatccaccgcgaccgcaacatgcgcggctattcgcaggaggccgtg
gtcgatacgatcctgcgccgcatgccggactatgtgaagtacatctgcccgcagttcagc
ctgacggacgtgaacttccagcgcgtgccgacggtggacaccagcaatcccttcgtcgcc
cgcgacattcccagctccgacgagagcatgctggtcatccgcttcgccaaccccaagggg
atcgacttcccctacctgctggcgatgctgaaggacagcttcatgtcccggcccaacacc
atcgtctgcccgggcgataagatggcgctggccatgcagttgatcttcacccccatgatc
tggcagctcatggatcgcaagaagaaggcgttctag

DBGET integrated database retrieval system