KEGG   Rhodospirillum centenum: RC1_4075Help
Entry
RC1_4075          CDS       T00785                                 

Definition
(GenBank) ABC transporter, periplasmic substrate-binding protein, putative
  KO
K02030  
polar amino acid transport system substrate-binding protein
Organism
rce  Rhodospirillum centenum
Brite
Transporters [BR:rce02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    RC1_4075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4298139..4298900)
Genome map
AA seq 253 aa AA seqDB search
MRHLAVLFLGLFLALPARAETITLRADLWCPYNCEPGQEPAGYLIDLAKAVFEPAGITVD
YQLMAYEDAIQAVRAGTVTAVVGAAKKDAPDLIFTSSAEGYSSYAFASPKGSGFRYTGPD
SLKGKRLGMIADYTYDDALDAYIAANKDTPAVVAVSGDAATHDLVMLLAQGKVDVIIESD
AVLEYTIEQMKLSNLFELNVASEGAPVYVAFSPADPKGAEHAKRLEDGIAALRQSGRLVE
ILKKYGLKDWVKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaccttgcggtccttttcctcggcctgttcctggcgttgccggcgcgggcggaa
accatcaccctgcgggcagacctctggtgcccctacaactgcgagccggggcaggagccg
gccggctatctgatcgatctggcgaaggccgtgttcgaaccggccggcatcaccgtcgat
taccagctcatggcctatgaggacgccatccaggcggtgcgggccggaacggtgacggcc
gtcgtgggcgcggcgaagaaggacgcgccggacctgatcttcaccagctcggcggagggc
tattcctcctatgccttcgcctcgcccaagggcagcggcttccgctacaccggacccgac
tcgctcaagggcaagcggctggggatgatcgccgactacacctacgacgacgcgctggac
gcctacatcgcggcgaacaaggacacgcccgccgtggtcgccgtgtccggcgatgccgcc
acgcacgaccttgtgatgctgctggcccaggggaaggtggatgtcatcatcgagagcgac
gccgtgctggaatacacgatcgagcagatgaagctgtccaacctgttcgagctgaacgtc
gccagcgaaggcgccccggtctatgtcgccttctccccggccgatcccaagggggcggag
catgcgaagcggctggaggacggcatcgccgccctgcgccagagcggccggctggtggag
attctgaagaagtacgggctgaaggactgggtgaagaagtag

DBGET integrated database retrieval system