KEGG   Rhodospirillum centenum: RC1_4076Help
Entry
RC1_4076          CDS       T00785                                 

Definition
(GenBank) ABC transporter, periplasmic substrate-binding protein, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ACJ01415
UniProt: B6IYP1
Position
complement(4299039..4299869)
Genome map
AA seq 276 aa AA seqDB search
MRTWLFTRVRLCGLAVLMLAGVPGALPARAETITLRADAWCPYNCAPGSARPGYVVEIAR
EVFAARGIEVDYALMPWARALESVRQGKISGVIGATRQEGEDLVFGEEAVGFSSDALAAR
RGYGFTYRGAESLDGHRLAAVRDYSYEPEIDAYIAAHAEAGEAVSLASGEDVTVQNLRKL
LANRVDLVLEDRNVLDYTLAAEGLTGLAESQAISAPEVIHIAFSPADPKAADHAAVLDAG
LREMRRSGRLAEILSRYGLTDWTVGHAAAVAPPPGR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgtggctgttcacaagggtgcggctttgcggactggccgtgcttatgctcgcc
ggcgtgcccggcgccctgccggcgcgggcggagaccatcaccctgcgcgccgacgcctgg
tgcccctacaactgcgccccgggcagtgcccgccctggctatgtggtggagatcgcccgc
gaggtgttcgccgcccgcggcatcgaggtggactatgccctgatgccctgggcgcgcgcc
ctggagtcggtgcggcagggcaagatctccggggtgatcggtgccacccggcaggagggc
gaggatctggtcttcggggaagaggccgtcggcttctcctccgacgcgctggccgcccgg
cggggatatggtttcacctacaggggcgcagagagcctggacggccaccgactggccgcc
gtgcgcgactacagctacgaaccggagatcgacgcctacatcgccgcccatgccgaggcg
ggcgaggccgtcagcctcgcgtccggcgaggacgtgaccgtgcagaacctgcgcaagctg
ctggcgaaccgggtcgatctggtgctggaggaccgcaacgtactggactacacgctggcc
gccgaagggctgacggggctggcggaaagtcaggcgatcagcgcgccggaggtgatccac
atcgccttctcccccgccgatccgaaggcggcggaccatgcggccgtgctggatgccggc
ctgcgcgagatgcgccggagcggccggctggcggaaatcctgagccgctacggcctgacg
gactggacggtcgggcatgccgcggccgtggcgcccccgcccgggcggtga

DBGET integrated database retrieval system