KEGG   Rhodospirillum centenum: RC1_4077Help
Entry
RC1_4077          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2336
Motif
Other DBs
NCBI-ProteinID: ACJ01416
UniProt: B6IYP2
Position
4300075..4301301
Genome map
AA seq 408 aa AA seqDB search
MSRPPESPPPALPPLDYDTAKALAADPDPAVRAGLAARADARPELLYYLADDDSPAVRRA
VAANAATPLRASARLARDRDDDVRVLLAGKLARALPGLTAAEQAALRDVAHHALELLAAD
QVVRVRAAVASALKDVDCAPPGLVARLARDVAREVAEPILRTCATLSDADLIAILKAQPQ
PWVADAIARRQAAGPGVSDAVPAGEAPPRPAPDLDPPPEPPAPVALPPALPGQVLAVRPA
VPEALAGRLSEAVQDSLHQALAEQGEFDPETLEAIAGTARRRIDWAREYARREPPEVRAR
RLHADGTLDEAAVLDALAWGDRPFVEIALALRAGIAAEVVHRILETQRPKSVTALCWRAG
LSMRAARVVQAKAARIPLRSVLNARHGTDYPLTEAEMRTLLALFDIPG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccctccggagagtccgccgccggcgcttccgccgctggactacgacacggcc
aaggccctggccgccgatcccgacccggcggtgcgggcggggctggcagcgcgcgccgac
gcgcggccggagcttctctactatctggccgatgacgacagccccgcggtgcgccgggcc
gtggcggcgaacgcggccacgccgctgcgggcctctgcccggctggcgcgcgaccgggac
gacgatgtgcgcgtgctgctggcgggcaagctggcccgcgccctgccgggtcttaccgcg
gccgagcaggccgccctgcgcgacgttgcccaccatgcgttggagcttctggcggcggac
caggtggtgcgggtccgggcggccgttgccagcgcgctcaaggacgtggactgcgctccg
cccggccttgtcgcccggcttgcccgcgatgtcgcccgcgaggtggcggagccgatcctg
cgcacctgcgccaccctgtccgatgcggatctgatcgccatcctgaaggcgcagccgcag
ccctgggtggccgacgccatcgcgcgccgacaggctgccggtccgggggtcagcgatgcc
gttccggccggggaggcgcctccccggccggcaccggacctcgacccgccgccggagccg
cccgcgcccgtcgccctgccgccggccctgcccgggcaggtcctggccgtccgcccggcc
gtgcccgaggccctggccgggcgcctgtccgaggcggtgcaggacagcctgcaccaggcg
ctggcggagcagggcgagttcgatccggagacgctggaggccatcgccggcacggcgcgg
cggcgcattgactgggcccgcgagtatgcccggcgcgagccgccggaggtccgcgcccgc
cgcctgcacgcggacggcacgctggacgaggcggcggtgctggatgcgctcgcctggggc
gaccgccccttcgtcgagatcgctctggccctgcgtgccggcatcgcggcggaggtcgtg
caccgcatcctggagacgcagcggcccaagagcgtgacggccctgtgctggcgtgccggg
ctttccatgcgggcggcccgggtcgtgcaggcgaaggcggcccgcatccccctgcgcagc
gtcctgaacgcccgccacggcaccgactatccgctgaccgaggcggagatgcggacgctg
ctcgcgctcttcgacattcccggctga

DBGET integrated database retrieval system