KEGG   Rhodospirillum centenum: RC1_4078Help
Entry
RC1_4078          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ01417
UniProt: B6IYP3
Position
complement(4301319..4301810)
Genome map
AA seq 163 aa AA seqDB search
MQHATPRRRSPPHRVRLPRLPGPPATMLTVLLALTVAGPARAQPDTAPSGPRAERELPQT
ASEPLGDCRLNANLLEIMIDPAMQSIPLWVRPFTSCCGPPPELVALRERCAVEEWRRVLV
DWTGRGPGVRPRGEDSGRLIEKEPRRPGLDDPAPGRTGPAGLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatgccacaccccgccgccggtccccgccgcatcgggtccgtctgccccggttg
cccggccccccggccacgatgctgaccgttctgctggccctgacggtcgcaggacccgcc
cgggcgcagccggacaccgccccctccggcccgcgggcggagcgggaactgccgcagacg
gcgtccgagccgctgggggactgccggctgaacgccaacctgctggagatcatgatcgac
cctgcgatgcagtcgatcccgctctgggtccggcccttcacttcctgctgcggcccgccg
ccggagctggtggccctgcgcgagcgctgcgcagtggaggagtggcgccgcgtcctggtg
gactggaccggccgcggccccggcgtccgtccccgcggcgaggacagcgggaggctgatc
gagaaggaaccccggcgcccgggcctggacgaccctgcccccggccggacgggtcccgcg
ggtctgcgctga

DBGET integrated database retrieval system