KEGG   Rhodospirillum centenum: RC1_4084Help
Entry
RC1_4084          CDS       T00785                                 

Definition
(GenBank) Chorismate mutase, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2 GATase_7
Motif
Other DBs
NCBI-ProteinID: ACJ01423
UniProt: B6IYP9
Position
4306053..4306910
Genome map
AA seq 285 aa AA seqDB search
MVPVSQTLNELRSEIDEIDAALHDLVMRRTALVEQIGAVKPPGRPALRPAREAEILRNLM
DRHQGAFPPAALSRMWREMISALTRLQGPFAVAVYAPDDQRGFWDLARDHYGSATPMQAA
NSSLAVLRLVAEGSATVGVLPWPEDDDPDPWWRYLFTADAKSPRIIARLPFLARAGREEV
EAMAIAALPLEETGDDRTLLGIELREDMSRGRLKDSLEAAGLPPLQLRTFHLPGGAGSVH
LTEVEAFVGPDDPRLAALYQRLGEALVRLLPIGTYATPIGLARRG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgtttcccagacgctgaacgagttgcgcagcgagatcgacgagatcgacgca
gccctccacgatctggtgatgcgccggacggcgctggtggagcagatcggcgccgtcaag
ccgcccggccgcccggccctgcgtccggcgcgggaggcggagatcctgcgcaacctgatg
gaccgccaccagggcgctttccctccggcagccctgtcccgcatgtggcgggagatgatc
tcggccctgacccgtctgcagggtcccttcgccgtcgcggtctatgccccggacgaccag
cgcggcttctgggatctggcgcgcgaccattacggcagcgccaccccgatgcaggcggcc
aacagcagcctcgccgtgctccgcctcgtggcggaagggtcggccaccgtgggcgtgctg
ccctggccggaggacgacgatcccgatccctggtggcgctacctgttcacggcggacgcc
aagtcaccgcgcatcatcgcgcgcctgcccttcctggcccgcgccggccgcgaggaggtg
gaggccatggccatcgccgccctgccgctggaggagacgggcgacgaccgcaccctgctg
ggcatcgagctgcgcgaggacatgagccgcggccgcctcaaggacagcctggaggcggcg
ggcctgccgccgttgcagctccgcaccttccaccttcccggcggtgccgggtcggtccac
ctgacggaggtggaggcgttcgtcggtcccgacgatccccgccttgccgcgctgtaccag
cggctgggggaggcgctggtgcggctgctgccgatcggcacctacgccacccccatcggc
ctcgcccgccgcggctga

DBGET integrated database retrieval system