KEGG   Rhodospirillum centenum: RC1_4085Help
Entry
RC1_4085          CDS       T00785                                 

Gene name
hisC
Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
rce  Rhodospirillum centenum
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RC1_4085 (hisC)
   00350 Tyrosine metabolism
    RC1_4085 (hisC)
   00360 Phenylalanine metabolism
    RC1_4085 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RC1_4085 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    RC1_4085 (hisC)
Enzymes [BR:rce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     RC1_4085 (hisC)
Amino acid related enzymes [BR:rce01007]
 Aminotransferase (transaminase)
  Class II
   RC1_4085 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4307021..4308109
Genome map
AA seq 362 aa AA seqDB search
MSGPIPNPGILDIAPYVGGEHSAPGVTRLLRLASNEGALGPSPRAVEAFRAVGPEIHRYP
DGGSTRLREAIGHRFGLDPARVLCFNGSDEVLHLLAQAYAGPGGEVLYSRHGFLVYPIAA
RAAGATPVAAPERNLTTDVDALLARVSERTRIVYVANPNNPTGSYLPADALARLHAGLPP
HVLLVIDAAYAEYVTANDYADGTALVARFDNVVMTRTFSKLFGLGGMRLGWAYCPPAVAD
ALHRVRSPFNVSVAAQAAGVAALEDLEFQERSRALNEQSRTAFTGRVRALGLVVHPSVCN
FVLVDFAATGRPAEEARQFLKARGILVRQMGAYGLPDCLRITMGLPAEMEEVADALGDWL
KG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtccgatccccaaccccggaatcctcgacatcgccccctatgtcggcggggag
cattccgcccccggcgtgacgcggctgctgcgccttgcctccaacgagggggcgctgggg
cccagcccccgcgcggtggaggcgttccgtgccgtcgggccggagatccaccgctatccc
gacggcggctcgacccggctgcgggaggccatcggccaccgtttcggcctcgatccggcg
cgggtgctctgcttcaacggctcggacgaggtgctgcacctgctggcccaggcctatgcc
ggcccgggcggggaggtgctctacagccggcacggcttcctggtctacccgatcgccgcc
cgcgccgccggggcgacgccggtggccgcaccggagcggaacctgaccaccgacgtggac
gccctgctggcccgggtcagcgagcggacccgcatcgtctatgtcgccaacccgaacaac
ccgaccggcagctatctgccggccgacgcgctggcgcgcctgcacgccggcctgccgccg
catgtcctgctggtgatcgacgcggcctatgccgagtacgtcaccgccaacgactatgcc
gacggcaccgccctggtggcccgtttcgacaatgtcgtgatgacccgcaccttctcgaag
ctgttcgggctgggcggcatgcgcctgggctgggcctactgcccgcccgccgtggcggat
gcgctgcaccgtgtccgcagccccttcaatgtcagcgtcgccgcccaggcggccggcgtc
gcggcgctggaggatctggagttccaggagcgcagccgggcgctgaacgagcagagccgg
accgccttcaccggccgggtgcgggcgctggggctggtggtgcatccctccgtctgcaac
ttcgtgctggtggacttcgccgccaccggccgcccggcggaggaggcgcggcagttcctc
aaggcgcgcggcatcctggtgcgccagatgggcgcctatggcctgccggactgcctgcgc
atcaccatgggcctgcccgcggagatggaagaggtggcggacgccctgggcgactggctg
aagggatga

DBGET integrated database retrieval system