KEGG   Rhodospirillum centenum: RC1_4086Help
Entry
RC1_4086          CDS       T00785                                 

Gene name
tyrA
Definition
(GenBank) prephenate dehydrogenase
  KO
K00220  
cyclohexadieny/prephenate dehydrogenase [EC:1.3.1.43 1.3.1.12]
Organism
rce  Rhodospirillum centenum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rce00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RC1_4086 (tyrA)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    RC1_4086 (tyrA)
Enzymes [BR:rce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     RC1_4086 (tyrA)
    1.3.1.43  arogenate dehydrogenase
     RC1_4086 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4308114..4309004
Genome map
AA seq 296 aa AA seqDB search
MTAPPLFPRVAVIGLGLIGSSLARVLRADPTLAGELVAADRSAAVCARVLELGLADRAET
DPACAVAGADLVILAVPIGACADLAAAIGPHLKPGAILTDVGSVKQAVIRDVAPQVPDGV
HFVPGHPIAGTEHSGPDAGFADLFRGRWCILTPPPGTDPAAVEKVVELWRRAGSMIEVME
PGHHDRVLAITSHLPHLIAYTIVGTATDLEEHLKSEVIRFSASGFRDFTRIAASDPVMWR
DIFLNNREAVLEIIQRFTEDLTALQRAIRWGEAETLEHLFTRTRDIRRGIIDARQA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccgccgctgtttccccgcgtcgccgtcatcgggctcggcctgatcgggtca
tcgctcgcccgcgtgctgcgcgccgacccgaccctggcgggggagctggtggcggccgac
cgcagcgcggcggtctgcgcccgggtgctggagctggggctggccgaccgggcggagacg
gacccggcctgcgcggtggcgggggctgacctcgtgatcctggccgtgccgatcggcgcc
tgtgccgaccttgccgccgccatcggcccgcatctgaagccgggcgccatcctcaccgat
gtcggctcggtcaagcaggcggtgatccgtgatgtcgccccgcaggtgcccgacggggtt
catttcgtccccggccatcccatcgccggcaccgagcattccgggccggacgccggcttc
gcggacctgttccgcgggcgctggtgcatcctgacaccgccgccgggcaccgatcccgcc
gcggtggagaaggtggtggagctgtggcgccgggccggctcgatgatcgaggtgatggag
cccggccaccatgaccgcgttctcgccatcaccagccacctgccgcacctgatcgcctac
accatcgtcggcacggcgaccgacctggaggagcacctgaagtcggaggtgatccgcttc
tccgcctcgggcttccgcgacttcacccgcatcgccgccagcgacccggtgatgtggcgc
gacatcttcctgaacaaccgcgaagcggtgctggagatcatccagcgcttcaccgaggat
ctgaccgcgctgcaacgggccatccgctggggtgaggcggagacgctggagcacctgttc
acccgcacccgcgacatccgccgcggcatcatcgacgcccggcaggcgtga

DBGET integrated database retrieval system