KEGG   Rhodospirillum centenum: RC1_4087Help
Entry
RC1_4087          CDS       T00785                                 

Gene name
rlpA
Definition
(GenBank) rare lipoprotein A, putative
  KO
K03642  rare lipoprotein A
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPBB_1
Motif
Other DBs
NCBI-ProteinID: ACJ01426
UniProt: B6IYQ2
Position
complement(4309008..4309571)
Genome map
AA seq 187 aa AA seqDB search
MPASARPAVFGARLIGATRLVGPPRLVGALWLALLLPATGARAGEPEAGTSAAREPVALD
RGEASFYGDGFQGRRTASGERFDQAKPTAASKDLPLGTRAEVTHLETGRSVEVTVNDRGP
YVEGRIIDLSKQAAKAVGLTKQEGTAPVEVVARPSDQPTEELRRKVLEVANGDDGEQAPP
APAATRP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcctccgcccgccccgccgtcttcggcgcccgtctcatcggtgccacccgcctc
gtcggccccccccgtcttgtcggtgccctctggctcgcgctcctactgccggccacggga
gcgcgggcgggcgaacccgaagcggggacgtccgccgcgcgggagccggtggccttggac
cgcggcgaggcgtccttctacggcgacggtttccagggccgcagaacggcatcgggcgag
cgcttcgaccaggcgaagcccaccgccgcctcgaaggatctgccgctgggaacccgggcg
gaggtgacccacctggagaccgggcggtcggtggaggtcaccgtcaacgaccgcggcccc
tatgtggaggggcggatcatcgacctgtcgaagcaggcggcaaaggcggtcgggctcacg
aagcaggagggcacggccccggtggaggtggtcgcccgtccctcggaccagccgacggag
gaactgaggcggaaggtcctggaggtggccaacggggacgacggggaacaggctccgccc
gcgccagcggcgaccaggccttga

DBGET integrated database retrieval system