KEGG   Rhodospirillum centenum: RC1_4090Help
Entry
RC1_4090          CDS       T00785                                 

Definition
(GenBank) transposase, is4 family
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4313027..4314148)
Genome map
AA seq 373 aa AA seqDB search
MAGIFRISFQGLPDPRTGNARRHALLDVLTIALTASICGAESCVDFATFARDRRALFEEF
LELPGGLPSHDTFSRVFRLLDPVAFSRCFQQFLDHLGEDGAGVLAIDGKTLRRSFDRAAG
RSALHVVSAFASGARMIVGQRAVAAGENEIVAARALLELFDLKGVLVTGDALHAQERTAQ
TILERGGDWLFPLKDNRPALRAEVERYFADPATVLAVPHVTTDADHGRIEVRRHWVSHDV
AWLASDRRFPDEAVLPGLKILGLVERTVTSPDGRTTATRTLYLSSAALEPKTLARAVRAH
WSIEAAVHWVLDTSFDEDRARNRKDHGPENLATLRKLALNVVRSANNQDSIRLRRKRAGW
SDDYARTILGQMR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctggaatttttcggatttcgtttcaaggtcttcccgatccgcggacagggaatgcg
cggcgtcacgctcttctggatgttctgacgattgcgttgacggcgtcgatctgcggggcg
gaaagctgcgtggactttgcgaccttcgcgcgggaccggcgggccttgttcgaggagttc
ctcgagcttcccggcgggctgcccagccacgacacgttttcacgggtattccggcttctg
gacccggtggcgttttcccgctgtttccagcagttccttgatcatctgggggaggatggg
gccggggtcctggccattgacggcaagacgctacggcgctccttcgaccgggcggcgggg
cgttcggctctacatgtggtgagcgcgtttgcgtccggcgcgcggatgatcgtggggcag
cgggcggtggccgcgggcgagaacgagatcgtggcggcgcgggcgttgctggaactgttc
gatctcaagggtgtgctggtaaccggtgacgctctgcacgcgcaggagcggacggcgcag
accatcctggagcggggcggcgactggctttttccgctgaaagacaaccgccctgcgcta
cgggccgaggttgagcgctacttcgcggacccggcaacggttctggccgtgccccatgtc
accaccgatgccgaccacggtcgtatcgaggtgcgccgccactgggtaagccacgacgtg
gcctggctcgcctccgaccgacgtttccccgacgaggccgtactgccgggcctgaagatc
ctgggcctggtcgaacgcacggtcacgagccccgacggccgcactaccgccacccgaacc
ctctatctctcctccgccgcgctggagcccaagacgctcgcccgcgccgtccgcgcccac
tggagcatcgaggccgccgtccattgggtgctcgacacctccttcgacgaagaccgcgcc
cgtaaccgcaaggaccatggcccggaaaacctcgccacactccgaaaactcgcactcaac
gtcgtccgctccgccaacaaccaggattccatccgcctccgcagaaaacgcgccggatgg
tccgacgactatgcccgaaccatcctcgggcaaatgcgatag

DBGET integrated database retrieval system