KEGG   Rhodospirillum centenum: RC1_4092Help
Entry
RC1_4092          CDS       T00785                                 

Gene name
chaC
Definition
(GenBank) cation transport protein ChaC, putative
  KO
K07232  
cation transport protein ChaC
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4314373..4314960
Genome map
AA seq 195 aa AA seqDB search
METAPPTVPAPHAEFGHPAGSDLWVFAYGSLMWNPGFPHLERRGALLRGWHRSFCVLSWR
HRGTPERPGAVLGLDRGGSCRGIVYRVAADRVEETLAYLWEREMVNRVYRPRRLAVRTAG
GGSAPALVFTVDRTHPQYCGRLGPEGLETLVRQGVGQSGRSADYLLSLVAHLRDLGIRDA
GLEDLAARVGGPPPD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgccccgccgaccgttcccgccccgcatgccgagttcggccacccggccggc
agcgacctctgggtcttcgcctacggctcgctgatgtggaatcccggcttcccgcacctg
gagcggcgcggggccctgctgcgcggctggcaccgctccttctgcgtgctgtcctggcgc
caccgcggcacgccggagcggccgggcgccgtgctgggcctggaccgcggcggttcctgc
cgcggcatcgtctaccgtgtcgccgcggaccgggtcgaggagacgctggcctatctctgg
gagcgggagatggtgaaccgcgtctaccgcccccgccggctggccgtgcggacggcaggg
ggcggcagcgccccggcgctggtcttcaccgtggaccggacgcacccgcagtactgcggc
cggctcgggccggaggggctggagacgctggtgcgccagggcgtgggccagtccggccgc
agcgccgactacctgctcagcctcgtcgcccacctgcgcgacctcggcatccgcgatgcc
ggcctggaggatctggccgcgcgggtgggcggacccccgccggactga

DBGET integrated database retrieval system