KEGG   Rhodospirillum centenum: RC1_4097Help
Entry
RC1_4097          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4322074..4322808)
Genome map
AA seq 244 aa AA seqDB search
MRFPFGGAQRADRPGGRLPDGEPPAGSGRHPLLHALFGGALTLAVAWFAGLFLFAAGLPR
TPPEDDRQTDAIVVLTGGSERLAAGFELLRAHRARKLFISGVYRGVDVQELLRLSRQAPG
DLECCIVLGYAADDTEGNAAETALWVRQEGFRSLRVVTANYHMPRSLVEFRRALPEVDLI
AHPVAPPNVRLEHWWRWPGTASLIVGEYNKFLLAWTRALLPVPAATPPADVPPGVWQRPE
PLSR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttcccttcgggggagcgcagcgggcggacaggccgggcggacgcctgcccgac
ggtgagccgccggcaggttccggacgccatccgctgctgcacgccctgttcggcggggcg
ctgaccctggccgtcgcctggttcgccggcctgttcctgttcgcggccgggctgccccgc
accccgcccgaggacgaccggcagaccgatgccatcgtcgtgctgaccggcggcagcgag
cggctggccgccgggttcgagctgctgcgggcgcaccgggcccggaagctgttcatctcc
ggcgtctaccgcggcgtggacgtgcaggaactgctgcggctgtcgcggcaggcgccgggc
gacctggaatgctgcatcgtgctgggctatgccgccgacgacaccgagggcaatgcggcg
gagaccgccctctgggtccggcaggagggattccgttcgctgcgggtggtcaccgccaac
taccacatgccgcgcagtctggtggagttccgccgcgccctgccggaggtcgacctgatc
gcccatccggtagcgccgcccaatgtccgtctggagcactggtggcgctggccgggcacg
gcgagcctgatcgtgggtgaatacaacaagtttctgctggcctggacccgcgccctgctg
ccggtcccggccgccacccctccggcggacgtgccgcccggggtctggcagcggccggaa
ccgctgagccgctga

DBGET integrated database retrieval system