KEGG   Rhodospirillum centenum: RC1_4098Help
Entry
RC1_4098          CDS       T00785                                 

Definition
(GenBank) cell division protein, putative
  KO
K09811  
cell division transport system permease protein
Organism
rce  Rhodospirillum centenum
Pathway
ABC transporters
Module
Cell division transport system
Brite
KEGG Orthology (KO) [BR:rce00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RC1_4098
Chromosome [BR:rce03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    RC1_4098
Transporters [BR:rce02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    RC1_4098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4322805..4323689)
Genome map
AA seq 294 aa AA seqDB search
MSRRGHYDIPLKRDATGRFLPWIIALMVYLASLSLVAAMVMSDLAARWDTGLSGSLTVQV
RPLSGKDAPTVEARVQDVLKRLEGRPSVTEVRALPHEEAVRLVEPWLGSGALLDDLPVPA
LIDLSLRPDADAKALAAELKGAVPGVEVDDPGDWLAGLRRLAATVQWVSAAVVGLIGAVA
VASVIFAASAGLAVHRAEVELLHVIGASDGYVAGQFQRHVLRLTLIGGAAGLVLALLTLW
GLDAAAQNLTAALLPRLSLTAEQWLSLAGVPAAAALLAAVTARLTVMRALERLP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcggccattacgacatccccctgaaacgcgatgcgaccggacgcttcctg
ccctggatcatcgccctgatggtctatctggcgagcctgtccctggtcgccgccatggtc
atgtccgatctggcggcgcgctgggacaccggcctgtcgggcagcctgacggtgcaggtc
cgccccctgtcgggcaaggacgcgccgacggtggaagcgcgggtgcaggacgtgctgaag
cggctggaaggccgcccatccgtgacggaggtccgcgccctgccgcacgaggaggcggtg
cggctggtcgagccctggctgggcagcggtgccctgctggacgatctgccggtgcccgcc
ctgatcgacctgagcctgcggcccgacgcggacgccaaggcgctggcggcagaactgaaa
ggcgccgtaccgggggtggaggtggacgatccgggcgactggctggccggcctgcgccgg
ctggcggcgacggtgcagtgggtgtccgccgccgtcgtcgggctgatcggcgccgtcgcc
gtcgcctccgtcatcttcgccgccagcgccgggctggccgtccaccgggcggaggtggaa
ctgctgcatgtgatcggcgcctccgacggctatgtcgccgggcagttccagcgccatgtg
ctgcgcctgaccctgatcggcggcgccgccgggctggtcctggcgctgctgaccctgtgg
gggctggacgcggcggcgcagaacctgacggcggcactgctgccgcggctgtcgctgacg
gcggaacagtggctgtcgcttgcgggcgtgccggcagcggcagccctgctggccgcggtc
accgcacggctgacggtgatgcgggccctggagcggctgccatga

DBGET integrated database retrieval system