KEGG   Rhodospirillum centenum: RC1_4100Help
Entry
RC1_4100          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4175 PHA_synth_III_E DUF4872 Borealin
Motif
Other DBs
NCBI-ProteinID: ACJ01439
UniProt: B6IYR5
Position
complement(4324879..4327524)
Genome map
AA seq 881 aa AA seqDB search
MQSRFRAREMPADAAETPALRRGKAPDAPGLRLHAARAALAWERLWPRLWPAVGVAGLFL
AAALFGLPPLLPGWLHLLVLLATAGGVGWLAVTRLRGFRWPGVEEGRRRLERDSALAHRP
LATLRDGRATGDGDPVADALWQMAQERARRQVRDLRLNAPHPNLLARDPWALRIALGLVL
LVAASVARDDWSERLGLALQPRIAGLGPAAPASLDVWITPPDYTGLPPVFLTRQPVPAAG
TEGDGADAAPAAPVDIPVGSTLLARVSGGSGTPELEIDGSATPFTGVAGGGFQIDRPVGA
GQRLSVTQRGRELGAWNIRVVPDMGPGIAFRTPPAATERHATRIDYTAADDYGVARAVAV
LTLAAETAPGIDRTPLELPLPLPGVTPRQVAATGFTDLTPHPWAGLPVSIRLEATDGAGQ
TGRSAEQPFVLPERPFSHPVAQAIIAERRRLTLGGDGVRDPVSRALSDISARPDGYRGDL
SVFMGLRSAVARLRRNQEPDALASVQDTLWETALRVEDGGLSLAERDLRDAQRELMEALD
RNAPDEEIDRLMQQLQQAMQQFMDALEEKVREAMERGEMPPEMPDMPNLQSMDRQGLEQM
MERMRELAQTGSREAARQMLSQLQQMMENLRTGQTGNQQQQGQEAARQAMEMMQQLQDLA
QRQQELMDETFRQSGEAQDEMLPPDMPLPGMQGPNRQPGQPQPGQPRPGQPGQAGPQGGD
PAGMAADQEALRRELGDLMRRFGEMGGEIPSPLGRAERAMRDAGEALEQGLPGQAVPSQG
QAVDQLQQGLETMVEQMQQQMMAAAGMRPGQRPQAGRQPGRDPLGRQLPGQGMFNTDRVK
IPEEGDVQRSREILEELRRRAGEPDRPKLERDYIERLLDRF
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccggttccgtgcccgggagatgcccgccgacgccgcggagacgcccgccctg
cgccgcggtaaggcgccggacgcccccggcctgcgcctgcacgcggcccgcgccgccctg
gcctgggagcggctgtggccccggctctggccggccgtgggcgtggccggcctgttcctg
gccgccgccctgttcggtctgccgcccctgttgccgggctggctgcacctgctggtgctg
ctggcgacggccggcggcgtgggctggctggccgtcacccggctgcgcggcttccgctgg
cccggggtggaggaaggccgccgccggctggagcgcgacagcgccctggcccaccggccg
ctggcgacgctccgcgacggccgcgccaccggcgacggcgacccggtggccgatgcgctc
tggcagatggcgcaggagcgggcgcggcggcaggtccgcgacctgcgcctgaacgccccg
caccccaacctgctggcgcgcgatccctgggccctgcggatcgccctggggctggtgctg
ctggtggcggcgagcgtcgcccgcgacgactggagcgagcggctggggctggcgctccag
ccccggatcgccgggctggggccggccgcgcccgcctccctggatgtctggatcacgccg
ccggactacaccggcctgccgcccgtcttcctgacccgccagcccgtgccggcggcggga
accgaaggggacggggccgacgcggcgcccgccgcgccggtggacatccctgtcggcagc
acactgctggcccgggtcagcggcggcagcggcacgccggaactggagatcgacggcagc
gccacgcccttcaccggggtcgccggcggcggcttccagatcgaccggccggtcggcgcc
ggccagcggctgagcgtgacccagcgcggccgggagctgggggcctggaacatccgggtc
gtccccgacatggggcccggcatcgccttccgcaccccgcccgccgcgacggagcgccat
gccacccggatcgactacaccgccgcggacgattacggcgtcgcccgggcggtcgcggtc
ctgaccctggcggcggagaccgcgccgggaatcgaccgcacgccgctggaactgccgctg
ccgctgcccggcgtgacccccaggcaggtggcggccaccggcttcaccgacctgacgccg
catccctgggccgggctgccggtgagcatccggctggaggccaccgacggcgccggccag
accgggcgcagcgccgagcagcccttcgtgctgccggaacggcccttcagccacccggtc
gcccaggccatcatcgccgaacggcggcgcctgaccctgggtggcgacggggtccgggac
ccggtgtcccgcgcgctctccgacatctccgcccggcccgacggctaccgcggcgacctg
tcggtcttcatggggctgcgctccgccgtggcgcggctgcgccgcaaccaggagccggac
gcgctggcctcggtccaggacacgctgtgggagacggccctgcgggtggaggacggcggc
ctgtccctggccgagcgcgacctgcgcgacgcccagcgggagctgatggaggcgctggac
cgcaacgccccggacgaagagatcgaccggctgatgcagcagctccagcaggccatgcag
cagttcatggacgccctggaggagaaggtccgcgaggccatggagcggggcgagatgccg
cccgagatgcccgacatgccgaacctccagagcatggaccgccaggggctggagcagatg
atggagcgcatgcgcgaactggcgcagaccggatcgcgcgaggcggcccggcagatgctc
tcccagctccagcagatgatggagaatctgcgcaccgggcagacggggaaccagcagcag
cagggccaggaggcggcccggcaggcgatggagatgatgcagcagctccaggatctggcg
cagcgccagcaggagctgatggacgagaccttccggcagtccggcgaggcgcaggacgag
atgctgccgccggacatgcccctgcccgggatgcagggaccgaaccgccagcccgggcaa
ccccagcccggccagccccgccccggccagccgggacaggccgggccgcagggcggcgat
cccgccggcatggccgcggaccaggaggcgctgcggcgcgagctgggcgacctgatgcgc
cgcttcggggagatgggcggggaaatccccagccccctgggccgcgccgaacgcgccatg
cgcgatgccggcgaggcgctggagcagggcctgcccggtcaggcggtgccgtcgcagggg
caggcggtggaccagctccagcaggggctggagaccatggtcgagcagatgcagcagcag
atgatggccgccgccggcatgcgcccgggccagcgcccgcaggcgggccgccagcccggc
cgcgacccgctgggccggcagcttcccggccagggcatgttcaacaccgaccgggtgaag
atcccggaggagggggacgtgcagcgttcgcgcgagatcctggaggaactgcgccggcgc
gccggggagccggaccgcccgaagctggagcgggactatatcgagcgcctgctggaccgg
ttctga

DBGET integrated database retrieval system