KEGG   Rhodospirillum centenum: RC1_4105Help
Entry
RC1_4105          CDS       T00785                                 

Definition
(GenBank) hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4331570..4333861
Genome map
AA seq 763 aa AA seqDB search
MNDSDDENSVFEAEVRRIARELFPKARINGPVIVDGRERDCVFNDGEVMHVIEATVSRRK
DKATKDLEKSAELVKSLRRQHQDVNFKIWFITKREPSADQSAVGSEIKKLAKCPVDVCSF
RTFSAKLVDASSYLSLRENHPFGSVRNPADDADYAVPREDYVQIDLLNFRDKSLVNVAYL
PERMSESPGVYLLVGDFGAGKSMTMRYMYDILADKYMSGSTTTFPVYLNLRDHFGQSNPS
EALLRHGNEIGFAAPNQLVAAWKAGHCHVFLDGFDELSSTRLVRGVGGLRAARREAMRLV
HAFVSHHPRDTSIFVGGRQHYFDSLEELEKALGLPSNFVHLTLNEFTHEQVTKFLKGKGF
NERVPNWLPSRPLLLGYLAIKGVLARHDPDISSLAREEGWDYLVDRICEREARQIDPISI
DPHAVREFVERLASWARRTNSGRGPVHLNNIYSIFEGVFSMPPDEKASTLIFRMPGLTSA
SGQEDAREFIDDDYVDACRSGDIIRFIESPHDPKSELLDESTINMGDLGASLSAYKLSGA
TAKKLSAALDSAARRNAPCLSFDVLRVMQQINASYVGPNIKISDGFFSEYQISASPDLSK
VTFSECYFNVVEIDEGANAGPEFVKCQIEKVVGCIGQKDLPSFVASSADGISKFEDEAQT
NADILDLPMPMSTKVLMTILRKLFVQAGRGRRENAFYRGLDGRSKVYVPEILQIIEKMEF
ASPSKNSGPVVWFPNRSLARDAHEILQAPLHSNHPLAAQVRIL
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcagacgacgagaattccgtattcgaagctgaggtgcgccgtatcgctaga
gaactttttccaaaggcgcggattaatggcccggttatagtggatggtcgtgagcgcgac
tgtgtttttaacgacggtgaggtaatgcatgttattgaagcaacagtatcacgcagaaaa
gataaagcgacaaaggacttagaaaagagcgccgaacttgtgaagtccctcaggaggcaa
caccaggacgtgaactttaaaatatggttcattacaaagagggagccgagcgctgatcaa
agtgctgtcggatcggagataaaaaagcttgcgaaatgcccggtcgatgtttgcagcttt
cggacattttcggcaaagctggtcgatgcttcaagttatttgagtttgcgagaaaatcat
ccttttggtagtgtgagaaatccggctgacgacgcggactacgcggtgcctagagaagat
tatgtccaaatagatcttttaaatttccgcgacaaatcattagttaatgtcgcttatctt
cctgagcgcatgtcggaatcgccaggagtttatctgttggtgggagatttcggggccgga
aaaagcatgacaatgaggtatatgtatgatattctggcagataaatacatgtcgggatcg
acgacaacatttccagtatatttgaatctgcgtgatcattttgggcagagcaaccccagt
gaagccctgctccggcatggcaatgaaattggctttgcggcgccaaatcagttggtggct
gcctggaaggcgggtcactgccatgtctttttagatggctttgatgagctgtcatccacg
aggctagttcgcggagtgggtggtcttagagcggctcggcgggaagcgatgcgtctagta
catgcttttgtatcgcatcatccgcgtgacacatcaatatttgttggtggtaggcagcac
tattttgatagtttggaggaattggaaaaagctcttggtttgccctctaattttgtgcac
ttgacgctgaatgagtttactcatgagcaggtgacaaaatttcttaaaggtaaaggattt
aatgaacgggttcccaattggctcccctcgcggcctctgctgctcgggtacttggctatt
aaaggcgttctggcgcgtcacgatcccgacattagttctcttgcccgagaagaaggttgg
gactatctcgtagatcggatatgtgaacgtgaggcgaggcagattgatccaattagtatt
gaccctcatgcagtaagagaatttgttgagcgcttggcgagttgggcccgtaggactaat
tctgggcgggggcccgttcacctaaataatatatattccatattcgaaggtgttttctct
atgccgcctgatgaaaaggcatcgacgttgatatttagaatgcctggtcttacctcggca
tctggtcaggaggacgcacgagagttcattgatgatgattatgttgatgcttgccggagt
ggtgatattattcggtttatagagtctccccacgatccgaaatcagagcttcttgatgaa
tcaaccataaacatgggagatcttggtgcaagtttatctgcttataagctgtctggggcg
actgctaaaaagctttcggccgctctcgattcggctgccagaagaaatgcaccctgttta
tccttcgatgtcttgcgagtaatgcagcagataaacgcgtcgtatgtggggccaaatata
aaaatatcagatggattctttagtgaataccaaattagcgcaagtccagatttgtcaaaa
gtgacattttcagaatgctattttaatgtagttgagattgatgagggcgcgaatgctggt
cctgaattcgttaaatgccaaatagagaaggttgttggctgtataggacaaaaagatctg
cctagttttgttgcctcttcggcggatggtatatcaaagtttgaggatgaggcccagaca
aatgcagatattctagacttgcctatgccaatgagcacaaaagtattaatgacaatctta
agaaagctttttgttcaggctggaagagggcggcgcgagaatgccttttaccggggcctc
gacggtagatctaaggtctatgttccggaaattctccagataatagagaagatggagttt
gcgtctccgagtaaaaatagtggaccggttgtttggttcccaaaccgtagcttagctcgt
gatgcgcatgaaattttgcaggcacctcttcattcaaatcatccgctggctgcccaggtt
cgaatactttga

DBGET integrated database retrieval system