KEGG   Rhodospirillum centenum: RC1_4109Help
Entry
RC1_4109          CDS       T00785                                 

Gene name
etfL
Definition
(GenBank) electron transfer flavoprotein, alpha subunit
  KO
K03522  electron transfer flavoprotein alpha subunit
Organism
rce  Rhodospirillum centenum
Brite
Exosome [BR:rce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RC1_4109 (etfL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETF ETF_alpha
Motif
Other DBs
NCBI-ProteinID: ACJ01448
UniProt: B6IYS4
Position
complement(4335110..4336051)
Genome map
AA seq 313 aa AA seqDB search
MTILVVAEPSEGPIKKPTLTTLGAAAKLGGPVHVLVAGKGAAAAAEAAGKAAGVTRVLLA
DAAEYEHPLAENLAPLVAKVAKDGGYGHVLFAATTFGKNVAPRVAAILDVQQISEISGVV
SADTFERPIYAGNAVATVQSSDAVKVVTVRGTAFEPAAAEGGSGTVESVSGSGDAGLSKF
VGAELSKSERPELTAARVVVSGGRGMQSGDNFHLLEALADKLGAAVGASRAAVDAGFVPN
DYQVGQTGKIVAPELYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQIADYGLVGDL
FKVVPELTEQIDK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctcgtcgttgcggagccctccgagggcccgatcaagaagccgaccctgacg
accctgggcgccgccgccaagctgggcggccccgtgcatgtgctggtcgccggcaagggt
gccgccgccgcggccgaggccgccggcaaggccgcgggcgtgaccagggtgctgctggcc
gacgccgccgagtacgagcacccgctggccgagaacctcgccccgctggtcgccaaggtg
gccaaggacggcggctacggccatgtcctgttcgcggccacgaccttcggcaagaacgtc
gccccgcgcgtcgccgcgatcctggacgtgcagcagatcagcgagatcagcggcgtcgtc
tccgccgacacgttcgagcggccgatctatgccggcaacgccgtcgccaccgtgcagtcg
tcggacgccgtgaaggtcgtcacggtgcgcggcacggccttcgagccggccgcggccgag
ggcggcagcggcaccgtcgagtccgtgtcgggcagcggcgacgccggcctgtccaagttc
gtcggggcggagctgtcgaagtccgagcggccggaactgaccgccgcccgcgtcgtcgtc
tccggcggccgcggcatgcagtcgggcgacaatttccacctgctggaagcactggccgac
aagctgggcgccgccgtcggcgcctcccgcgcggcggtggacgccggcttcgtgccgaac
gactaccaggtcggccagaccggcaagatcgtggcgccggagctgtacatcgccgtcggc
atctcgggggccatccagcatctggccggcatgaaggacagcaaggtgatcgtcgccatc
aacaaggacgaggaggcgccgatcttccagatcgccgactacggcctggtgggcgatctt
ttcaaggtcgtgcccgagttgaccgagcagatcgacaagtaa

DBGET integrated database retrieval system