KEGG   Rhodospirillum centenum: RC1_4110Help
Entry
RC1_4110          CDS       T00785                                 

Gene name
etfS
Definition
(GenBank) electron transfer flavoprotein beta subunit
  KO
K03521  
electron transfer flavoprotein beta subunit
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4336067..4336816)
Genome map
AA seq 249 aa AA seqDB search
MKILVAVKRVVDYNVKIRVKPDNTGVELANVKMSMNPFDEIAVEEAVRLKEAGKATEIVV
VSIGPAAAQETLRTALAMGADRGVLVQTDAETEPLAVAKALKAIAEKEQPGLVIVGKQAI
DDDANQTGQMLAALLGWPQGTFASKVVAAEGSVAVTREVDGGLETVELKLPAVVTTDLRL
NEPRYASLPNIMKAKKKPIETLTPDQVGVDFSPRLKTLKVTEPAKRKGGVKVADVAALVD
KLRNEARVI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactggtcgccgtgaaacgggtcgttgactacaacgtcaagatccgcgtcaag
ccggacaacaccggcgtcgaactcgcgaacgtgaagatgtccatgaatccgttcgacgag
atcgcggtggaagaggccgtgcgcctcaaggaagccggcaaggcgacggagatcgtggtc
gtgtccatcggtccggccgccgcgcaggagaccctgcgcacggcgctggccatgggggcc
gaccgcggcgtgctggtgcagaccgacgccgagaccgagccgctggccgtggcgaaggcg
ctgaaggccatcgccgagaaggagcagccgggcctcgtcatcgtcggcaagcaggcgatc
gacgacgacgccaaccagaccggccagatgctggccgcgctgctgggctggccgcagggc
accttcgcctccaaggtcgtggcggccgagggctccgtcgccgtcacccgcgaggtggac
ggcggcctggagacggtggagctgaagctgccggcggtggtgaccaccgacctgcgcctg
aacgagccgcgctacgcctcgctgccgaacatcatgaaggcgaagaagaagcccatcgag
accctgaccccggatcaggtgggcgtggacttcagcccccgcctgaagacgctgaaggtc
accgagccggcgaagcgcaagggcggcgtcaaggtggccgacgtggccgcgctggtggac
aagctgcgcaacgaagcccgcgtgatctga

DBGET integrated database retrieval system