KEGG   Rhodospirillum centenum: RC1_4114Help
Entry
RC1_4114          CDS       T00785                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ01453
UniProt: B6IYS9
Position
complement(4339046..4339525)
Genome map
AA seq 159 aa AA seqDB search
MHDTAAIDHYRRLAQDTTIDGTTLLSTDYFNHFNEVIMLLSMLGDMPDMLEEVKAWRPKT
YAEHFRGSGLHFAPLAIECYENAPPEYRDPFDLTIDELNATIADALTELDASKDDPARMG
DVAVDYWQRLQALVDRGSAIVHGSMPQATLDQSAIDDLF
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataccgcagccatcgaccattaccggcgcctcgcgcaggacaccaccatcgac
ggcacgaccctgctgtcgacggactacttcaaccatttcaatgaagtgatcatgctcctc
tcgatgctcggcgacatgccggacatgctggaggaggtgaaggcctggcggcccaagacc
tatgccgaacatttccgcggcagcggcctgcatttcgcgcccctggccatcgagtgttac
gagaacgcgccacccgaatacagggatccgttcgacctgacgatcgacgagttgaacgcc
accatcgccgacgcgctgacggaactggacgcctcgaaggacgatccggcgcggatgggc
gacgtggccgtggactactggcagcgcctccaggcgctggtggaccggggcagcgccatc
gtccacggctcgatgccgcaggcgacgctggaccagtcggccatcgacgatctgttctga

DBGET integrated database retrieval system