KEGG   Rhodospirillum centenum: RC1_4115Help
Entry
RC1_4115          CDS       T00785                                 

Gene name
gltX
Definition
(GenBank) glutamyl-tRNA synthetase GltX
  KO
K01894  
glutamyl-Q tRNA(Asp) synthetase [EC:6.1.1.-]
Organism
rce  Rhodospirillum centenum
Brite
Enzymes [BR:rce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.-  
     RC1_4115 (gltX)
Amino acid related enzymes [BR:rce01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   RC1_4115 (gltX)
Transfer RNA biogenesis [BR:rce03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    RC1_4115 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4339664..4340560)
Genome map
AA seq 298 aa AA seqDB search
MTASAAPSAPVVTRFAPSPTGYLHLGHAHSALAGWRAARSAGGRFLLRIEDIDPQRCRPE
FDAAIREDLAWLGLDWDGPVRRQSEHPDDYRAALARLRALGVLYPCFCSRKEIQEEIARA
GHAPHLTPTAAGGAPGPEGPLYPGTCRRLDPGEAQARLAEGRPHAWRLDIARALELTGPL
CWHDRERGMQTAVPGILGDVVLARRDTPTSYHLSVTVDDHLQGVTLVTRGVDLFEATHVH
RLLQALLGLAVPEYHHHGLLTNAAGERLSKRDGAKALRALRAEGWTPAAVRTLAGFPD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccgccgccccgtccgcccccgtcgtcacccgcttcgcgcccagcccgacc
gggtatctgcatctgggccacgcgcattccgccctggccggctggcgcgccgcccgcagc
gctggcgggcgtttcctgctgcgcatcgaggacatcgacccgcagcgctgccggccggag
ttcgacgccgcgatccgcgaggatctggcctggctggggctggactgggacgggccggtg
cgccgccagtccgagcatccggacgattaccgggcggcgctggcgcggctgcgggcgctc
ggtgtgctctatccctgtttctgttcgcgcaaggagatccaggaggagatcgcccgcgcc
ggccacgccccgcacctgacgccaacggcggcgggcggtgcgccggggccggaggggccg
ctctatcccggcacctgccgccggctggaccccggggaagcgcaggcgcggctggcggag
ggacggccgcacgcctggcggctggacatcgcccgcgccctggagctgaccgggccgctc
tgctggcacgaccgcgagcgcgggatgcagaccgccgtgcccggcatcctgggcgacgtg
gtgctggcccggcgcgataccccgaccagctaccacctgtccgtcacggtggacgatcac
ctccagggggtcaccctggtcacccgcggggtggacctgttcgaggcgacccacgtccac
cggctgttgcaggccctgctggggctggccgtgccggaataccaccaccacgggctgctg
acgaacgccgccggcgagcggctgtccaaacgcgacggggcgaaggccctgcgcgcgctg
cgggcggagggatggacgccggcggcggtgcggacgctggccgggttccccgactga

DBGET integrated database retrieval system