KEGG   Rhodospirillum centenum: RC1_4117Help
Entry
RC1_4117          CDS       T00785                                 

Definition
(GenBank) HNH endonuclease family protein, putative
Organism
rce  Rhodospirillum centenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4340880..4341449
Genome map
AA seq 189 aa AA seqDB search
MALMPPLDSCPALVLNADFRPLSYFPLSLWSWQEAVKAVVLDRVNIISVYDRVVRSPTQE
IRLPSVISLKEYIPATRRPAFTRFNVFLRDRFSCQYCSRSFPTQELTFDHVIPRSKGGRT
TWENVVTSCSACNLMKGSRYPHQCGMFPVQPPFQPTAHQLQENGRSFPPNYLHQSWRDFL
YWDSELEPF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggcattgatgccaccgctcgacagttgtccggctttggtgctgaatgcggatttccgg
ccgctcagctacttccccctgtcgctctggtcgtggcaggaggcggtgaaggccgtggtc
ctggaccgggtgaacatcatctccgtctacgaccgcgtggtccggtccccgacgcaggag
atcaggctgcccagtgtcatcagcctgaaggaatacataccggcgacacgaaggccggcc
ttcacaaggttcaacgtcttcctccgcgaccgcttctcctgccagtactgtagtcgaagt
tttcccacccaggaactgaccttcgaccatgtgattccccggtccaaaggcggacggacc
acctgggaaaatgtcgtcaccagttgttccgcctgcaatctgatgaagggcagccgctat
ccccaccagtgcgggatgtttccggtccagccgcccttccagcccaccgcccatcagctt
caggagaacggccggtccttcccgccgaactacctgcaccagagctggcgcgatttcctc
tactgggattcagagctggagccgttctga

DBGET integrated database retrieval system