KEGG   Ruminococcus champanellensis: RUM_01060Help
Entry
RUM_01060         CDS       T02600                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rch  Ruminococcus champanellensis
Pathway
rch00521  Streptomycin biosynthesis
rch00523  Polyketide sugar unit biosynthesis
rch01130  Biosynthesis of antibiotics
Module
rch_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RUM_01060
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RUM_01060
Enzymes [BR:rch01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RUM_01060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: CBL16376
UniProt: D4L9T1
Position
complement(120077..120685)
Genome map
AA seq 202 aa AA seqDB search
MGQIKVDQHVGGIQGLCIIQPAVHGDSRGYFMETYNQNDMQEAGLDIAFVQDNQSCSTKG
VLRGLHFQKQFPQTKLVRVIRGSVFDVAVDLRSNSATYGKWFGVELTAENKKQFLIPKGF
AHGFLVRSEIAEFCYKCDDFYHPGDEGGLAWNDPAIGIDWGVTGTYPGSASGSGYTLPDG
TGLMLSEKDQLWLGIQDTFKFN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacagatcaaggtcgatcagcatgtaggcggcatccagggactatgcatcatccag
cccgccgtgcatggggacagcaggggctattttatggaaacctataaccagaacgatatg
caggaagccggactggacattgcctttgtacaggataaccagtcctgctccacaaagggt
gttctgcgggggctgcactttcagaagcagttcccccagaccaagctggtacgggtcatc
agaggcagcgtgtttgacgttgccgtagacctgcggagcaattcagcaacctacggcaag
tggttcggcgtagagctgaccgccgagaacaagaagcagttcctgattccaaagggcttt
gcacacggcttcctggtgcgcagcgagatcgccgagttctgctataaatgcgacgacttc
tatcaccccggggatgagggcggccttgcctggaatgacccggctatcggcatcgactgg
ggcgtaaccggcacatatcccggctccgcctccggcagcggctataccctgccggacggt
accggactgatgctcagcgaaaaggatcagctgtggctgggcattcaggatacgttcaag
tttaactaa

DBGET integrated database retrieval system