KEGG   Ruminococcus champanellensis: RUM_03230Help
Entry
RUM_03230         CDS       T02600                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rch  Ruminococcus champanellensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    RUM_03230
  Lipid metabolism
   00561 Glycerolipid metabolism
    RUM_03230
   00600 Sphingolipid metabolism
    RUM_03230
Enzymes [BR:rch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     RUM_03230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(351364..353562)
Genome map
AA seq 732 aa AA seqDB search
MHITYDETLKLFRLTAGDMLYAMGITDGAYLAHIYFGKNLPDADLTELLRLDEPPFTPSV
NNRDKACYMDTLPFECPCFGLGDYREHAVEILDGAGMSTCDFRYVSHRIIPGKPGLPGLP
ATFGTEQQAMTLCILCRDEHADLELELRYSVFEQMHTIVRSAIVRNTGRADCRLKRLLSA
TLTLDGDGYDMLTLNGSWARERHVERCRLHMGKQRIDSMRGESSHQHNPFFALAEQGADE
DRGVCYGLNLIYSGNFMAQAEVDQHHTTRAQIGINPTDFTWLLPPGEAFAAPEAVLVWSE
EGLGGMSRTFHDLYRQHLIRSKYRALPRPVLINNWEATYFDFNEEKLLSIAREAAKLGIE
MLVMDDGWFGHRDKDNSSLGDWYVYEKKLPGGLKSLVDKVRAMGLKFGIWFEPEMVSPDS
DLYRAHPDWAIQVPGRELTLCREQYVLDYSRQDVREYVYGMLRDILTSADISYVKWDMNR
QLTEVGSRMLPADRQRELWHRYVLGVYEMMERLVTEFPDLLLENCSGGGARFDPGMLYYS
PQIWASDDTDAMERLKIQYGTSLCYPVSAMGAHVSDCPNHTVGRTTPFQTRGHVAMAGTF
GYELDITKISPEDRGQIPGQIADYKRYSHIMRNGDQYRIGDPFGTAGYDAWIFVAKDKGE
ALFTYVQTLSRPNVRSRRIRLKGLNPESWYRCSENGKTYSGAYLMQAGLRMPNLWGDFQS
RQIYLNKMEERA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcacctatgacgaaaccctgaagctgttccggctcaccgccggggatatgctg
tacgccatggggatcacggacggggcgtaccttgctcacatatatttcgggaaaaatctt
ccggatgctgatctgacggagctgctgcggctggatgaaccccccttcaccccctctgtg
aataaccgggacaaggcgtgttatatggacaccctgccctttgagtgcccctgcttcgga
ctgggggattaccgggagcatgcagtggagatcctggacggggcaggcatgagcacctgt
gacttccggtatgtgtcccaccgcatcatccccggcaagccgggactgccgggactgcct
gccaccttcggcacggagcagcaggcaatgaccctgtgcatcctgtgccgggacgagcat
gcagacctggagctggagctgcggtattccgtgtttgaacagatgcatacgatcgtgcgc
agcgccattgtccggaacaccggaagggcggactgccggctgaagcggctgctgagcgcc
accctgaccctggacggagacgggtatgatatgctgacgctgaacggctcctgggcacgg
gagcggcatgtggaacggtgccggctccacatgggcaagcagcggatcgacagcatgcgg
ggggaaagctcccaccagcacaacccctttttcgccctggcggagcagggtgcggacgaa
gaccggggggtatgctacgggctgaatctgatctactccggcaatttcatggcacaggcg
gaggtggatcagcaccacaccacccgtgcccagatcggcatcaaccctacggatttcacc
tggctgctgccccccggggaggcatttgccgcaccggaggcagtgctggtctggtcggag
gaggggctggggggtatgtcccgcaccttccacgatctgtaccggcagcatctgatccgc
agcaagtaccgggctctgccccggccggtgctcatcaacaactgggaagccacctacttc
gacttcaacgaggaaaagcttctgtccatcgcccgggaggcggcaaagctgggcatcgaa
atgctggtaatggacgacggctggttcggacaccgggacaaggacaattccagtctgggg
gactggtatgtgtacgaaaagaagctgcccggcgggctgaaatccctggtggacaaggta
cgggcaatggggctgaaattcggcatctggttcgagccggaaatggtctccccggacagc
gacctgtaccgtgcccacccggactgggcgatccaggtgcccggcagggagctgaccctg
tgccgggagcagtatgtactggattattcccggcaggatgtgcgggagtatgtgtacggc
atgctccgggacattctcaccagtgcggacatttcctatgtcaagtgggatatgaaccgg
cagctgacggaggtgggctcccggatgcttccggcagaccggcagcgggagctgtggcac
cggtatgtgctgggggtctatgagatgatggagcggctggtaacggaatttccggatctg
ctgctggaaaactgctccggcggcggtgcccggttcgatccgggcatgctgtactacagt
ccccagatctgggcatcggacgatacggacgctatggagcggctgaagattcagtacggc
acctccctgtgctacccggtttccgccatgggcgctcacgtcagcgactgccccaaccat
acggtgggcagaaccacccccttccagacccgggggcatgtggcgatggcaggcaccttc
ggctatgagctggacattacgaagatctccccggaggatcggggtcagattcccggtcag
atcgccgattacaagcggtacagccacatcatgcggaacggggatcagtaccggatcggg
gatcccttcggcacggcaggctatgacgcctggatctttgtggccaaagacaagggagag
gcgctgttcacctatgtgcagaccctgtcccgacccaatgtgcgctcccggcggatccgg
ctcaagggactgaacccggaaagctggtaccggtgcagcgaaaacggaaaaacctacagc
ggcgcttatctcatgcaggcagggctgcgcatgcccaacctgtggggggatttccagagc
cgacagatctatctgaataaaatggaggaacgagcatga

DBGET integrated database retrieval system