KEGG   Ruminococcus champanellensis: RUM_05520Help
Entry
RUM_05520         CDS       T02600                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rch  Ruminococcus champanellensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rch00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(601251..602576)
Genome map
AA seq 441 aa AA seqDB search
MLKKLWAYLSAAAVSVAMLGSMSANAAYVKANDYTRNLSVTDVTAVQDYLTAKCDTVNSL
ADLNQDEVIDAMDLALHKRILLGNLELLEPPTQMRDLTASQLLDEITIGWNLGNTLDATT
TSWLPNPTPAQSETAWGCPMTTKAMIDKVKEGGFNTVRVPVSWIDHTGSAPEYQIDEAWM
NRVQEVVNYVIDNDMYCILNIHHENDWLIPTNAQKDSVNARLDAIWTQIATRFGSYDEHL
IFEGMNEPRLVGDPNEWNGGNQEARQVINSYNQTFVNTVRATGGNNAIRCLMVPTYAASC
SSTTVNDFVLPTDTVANKLIVDIHSYSPYNFALNTSGTSSFTQSDISQLQWTLQEIYNSF
GAKGIPVIIGEFGALNKNNINGRVLWGENYLRIAKSYNIRCIWWDNNAFDTSGENFGLLN
RGTLTWQYPELLEAMMKGLNS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaaactatgggcatacctgagcgctgctgccgtcagcgtggcaatgctgggt
tccatgtccgcaaacgccgcttatgtgaaggcaaacgactacacccggaacctgtccgta
acggatgtaaccgcagtgcaggactatctgaccgcaaagtgcgatacggtcaattctctg
gcagatctgaaccaggacgaagtcattgatgccatggatctggcgctgcacaagcggatt
ctgctgggaaacctggagcttctggagccgcccacacagatgcgggatctgaccgcaagc
cagctgctggacgagatcaccattggctggaacctgggcaacaccctggacgctaccaca
acctcctggctgcccaatcccacaccggcacagtcggaaaccgcctggggctgtcccatg
accaccaaggcaatgatcgacaaggtgaaggaaggcggctttaacactgtccgtgttcca
gttagctggatcgaccataccggcagtgcaccggagtaccagatcgacgaggcttggatg
aaccgggtacaggaagtggtcaactatgtgatcgacaatgacatgtactgcattctcaac
attcaccacgaaaacgattggctgattcccaccaacgcccagaaggacagcgtcaacgcc
cggctggatgccatctggacccagatcgccacccggttcggcagctacgatgagcatctg
attttcgagggcatgaacgagcctcggcttgtgggagatcccaacgagtggaacggcggc
aaccaggaagcacgacaggtcatcaacagctacaaccagacctttgtgaacaccgtccgg
gcaactggcggcaacaatgccattcgctgtctgatggtacccacctatgcggcatcctgc
tcctccacaacggtgaatgacttcgtgctgcccacggatacggttgccaacaagctgatc
gtggacatccacagctactcgccctataactttgcactgaataccagcggcacctccagc
ttcacccagtctgacatcagtcagctccagtggaccctccaggagatctacaactccttc
ggcgcaaagggcattccggtcatcatcggagaattcggcgctctgaacaaaaacaacatc
aatggccgggtactctggggggagaattatctccgcatcgccaagagctacaacatccgt
tgcatctggtgggataacaacgccttcgacaccagcggcgagaatttcggactgctgaac
cgaggaactctgacctggcagtatccggagctgctggaggccatgatgaagggattaaac
agttaa

DBGET integrated database retrieval system