KEGG   Ruminococcus champanellensis: RUM_06280Help
Entry
RUM_06280         CDS       T02600                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rch  Ruminococcus champanellensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RUM_06280
Enzymes [BR:rch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RUM_06280
Exosome [BR:rch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RUM_06280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679994..681934
Genome map
AA seq 646 aa AA seqDB search
MIPDLQKENEFPLSLFLSGKNCKSYLFFGAHTISSKGTQYHCFRVWAPHARSVSLVGDFN
RWDRSQTPMHAIGGGVWECCIPRLEQFAAYKYSIKGRDGKIRMKADPYGAHYETRPATAS
KIYESSYEWKDDAWRKAKRQRNIYKSPVNVYEVHFNSWRINPDGSFLDYRTFAKQMIPYL
QKMSYTHIEFMPLTEYPYDGSWGYQVTGYFAPTSRFGTPDDFRAMVDAFHAAGIGVILDW
VPAHFPKDEHGLFEFDGGCCYEYEDVRKGEHFAWGTKVFDYGRPEVCSFLISSACCWFEE
FHVDGLRVDAVASMLYLDYDRPDGQWCPNKNGGRENLEAIDFLRHLNEAVFEKFPDALMI
AEESTAWPMVTKPTCDGGLGFNFKWNMGWMNDMLSYMSMDPLFRSGNHDKLTFSFFYCFS
ENYVLPISHDEVVHGKCSMIGKMSGGYDQKFDSYRAFLGYMMAHPGKKLLFMGQEFAQMK
EWDYQHQLDWMLLDYPKHNTMLKYTRKLNRFYAEHPPLWERDDSWDGFSWIANDDYQQSV
IAFRRFDDKGEELIVVCNFVPVERREYRIGVPYKGSYKLLFNSDATEFGGSGAAEKAVKS
EAIPMHGFDNSIALTLAPLSTMFFKPVPYKKRRSTKKSAPSKAAQK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgattccggatctgcaaaaagaaaatgaatttccgctgtctttgtttttgagcgggaaa
aattgcaagtcctatttatttttcggcgcacacacgatatccagcaagggtacacagtat
cattgcttccgggtctgggcgccccatgcccgatccgtttccctggtgggagatttcaac
cgctgggacagaagtcagacccccatgcacgccatcgggggcggcgtatgggaatgctgc
attccccggctggagcagttcgctgcctataaatacagcatcaagggcagggacggcaag
atccgtatgaaggcggatccttacggagcgcattatgagacccggccagccactgcctcc
aagatctacgagagcagctatgaatggaaggatgatgcctggcgcaaagccaagcggcag
agaaatatttacaaaagcccggtgaatgtgtacgaagtacattttaactcctggcgcatc
aatccggacgggagctttctggattaccggacctttgcaaagcagatgatcccgtatctg
caaaaaatgtcttatacccatattgagttcatgcccctgacggagtatccctacgacggc
tcctggggctatcaggtcacgggctatttcgcccccacctcccggtttggtacgccggat
gatttccgtgccatggtggatgcgttccatgctgccggcatcggggtgatcctggactgg
gtaccggcgcacttccccaaggatgaacacggcttgttcgagtttgacggtggatgctgc
tacgaatacgaggacgtgcgcaagggggagcatttcgcctggggcaccaaggtgttcgat
tacggcaggccggaggtgtgctccttcctgatctccagcgcatgttgctggtttgaggaa
tttcacgtagatggtctccgggtggatgcggtggcatccatgctgtacctggattatgac
cggccggatggtcagtggtgccccaacaagaacgggggcagggagaatttagaggcaatt
gattttctgcggcatctgaatgaagcggtgtttgaaaagttcccggatgcgttgatgatc
gccgaggaatccaccgcctggcccatggtcaccaagcccacctgcgacgggggtctgggg
tttaactttaaatggaatatgggctggatgaacgatatgctcagctatatgtccatggat
cctctgttccgctccggcaaccacgataagctgaccttctcgttcttctactgtttttcc
gaaaattacgtgctgcccatttcccacgatgaagtggtgcatggcaaatgctccatgatc
ggcaagatgagcggcggctacgatcaaaaattcgactcctaccgggcgtttcttggctat
atgatggcgcatccgggcaagaagcttctctttatgggacaggagtttgcccagatgaag
gagtgggattaccagcaccagctggactggatgcttctggattaccccaagcacaacacc
atgctcaagtacacccggaaattgaatcggttttatgcggagcatccgcccctgtgggag
cgggacgactcctgggatggattcagctggatcgccaatgacgattatcagcaaagcgtc
attgccttccgccggtttgacgacaagggtgaggagctgatcgtggtgtgcaactttgtg
ccggtggagcggcgggaataccggatcggtgtgccctataagggcagctataagctgctg
ttcaattcggacgccacggaattcggcggctccggcgcagcagaaaaagccgtcaaatcc
gaagccatccccatgcatggctttgacaacagcattgcgctgacgctggcacccttgtcc
accatgttcttcaagccggtgccgtataaaaaacgcagatcgactaagaaatccgcaccg
tccaaagcggcgcagaaatag

DBGET integrated database retrieval system