KEGG   Ruminococcus champanellensis: RUM_06920Help
Entry
RUM_06920         CDS       T02600                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rch  Ruminococcus champanellensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RUM_06920
Enzymes [BR:rch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RUM_06920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(754129..754662)
Genome map
AA seq 177 aa AA seqDB search
MGSSKTANALMVRYNYVEKGKKVVLLKPKCENRDGEKTIRSRIGLEDPCEFAEEFLEQYS
GEHYDCIIVDEVQFLAAEVINRLSDLVDTYGITVICYGLRTDFRSELFPGAKRLMELADD
IEQIKTICWCGKRAHFNARILNGEMVTEGEQVQLGGNESYMALCRKHYKERQIKPQK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctccaagactgccaatgcactgatggtacggtataactatgtcgagaaaggc
aagaaggtcgtccttctgaagccaaaatgcgagaatcgggacggcgagaaaaccatacgc
tcccgcatcggattagaagatccatgcgagtttgcagaggaatttctggaacagtacagc
ggagagcattatgactgcattattgtagacgaagtacagttccttgctgcggaggtcatc
aacaggctaagtgatctggtagatacctacggcattaccgtaatctgttacggtctgcgg
acggatttcagaagcgaactgtttccgggagccaagcgtctcatggagctggctgacgat
atagagcagatcaagacgatatgctggtgcggcaagcgggcacacttcaatgcccggata
ctgaacggagagatggtcactgagggtgaacaggtgcagctcggcggcaacgagagctat
atggcactgtgccggaagcattataaggaacgacaaataaagccacagaaataa

DBGET integrated database retrieval system