KEGG   Ruminococcus champanellensis: RUM_11300Help
Entry
RUM_11300         CDS       T02600                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rch  Ruminococcus champanellensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RUM_11300
   00051 Fructose and mannose metabolism
    RUM_11300
Enzymes [BR:rch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RUM_11300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1237663..1238988
Genome map
AA seq 441 aa AA seqDB search
MSEFFTGISKIPFEGKASNNPMAFKYYNPDEVVGGKTMREQLKFALSWWHTMGGDGTDMF
GVGTTNKKFGGTDPMDIAKRKVNAAFELMDKLSIDYFCFHDRDLAPEADNLKETNQRLDE
ITEYIAQMMQLNPDKKVLWGTANCFGNPRYMHGAGTAPNADVFAFAAAQIKKAIEITVKL
GGKGYVFWGGREGYETLLNTNMGLELDNMARLLHMAVDYARSIGFTGDFYIEPKPKEPTK
HQYDFDTATVIGFLRKYNLDKDFKMNIEANHATLAQHTFQHELRVARENGFFGSIDANQG
DTLLGWDTDQFPTNTYDAALCMYEVLKAGGFTNGGLNFDSKARRGSFEMEDIFHSYIAGM
DTFALGLKIAQKMIDDGRIDQFVADRYASWNTGIGADIISGKATMADLEAYALSKGDVTA
SLKSGRQELLESILNNIMFNL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattttttacaggcatttcaaagatcccctttgagggaaaggcatccaacaat
cccatggcgttcaagtactacaacccggatgaggtcgtaggcggcaagaccatgcgggag
cagctgaagtttgcgctgtcctggtggcatactatggggggagacggtacggacatgttt
ggtgtgggtaccaccaacaagaagttcggcggaaccgatcccatggacattgctaagaga
aaggtaaacgctgcgtttgagctgatggacaagctgtccatcgattatttctgtttccac
gaccgggatctggcgccggaggctgataatctgaaggaaaccaaccagcgtctggatgaa
atcaccgagtatattgcacagatgatgcagctgaacccggacaagaaggttctgtggggt
actgcaaattgcttcggcaatccccggtatatgcatggtgccggcactgcgcccaatgcg
gacgtgtttgcatttgcagctgcgcagatcaaaaaggcaattgagatcaccgtaaagctg
ggtggcaagggctatgtattctggggcggcagagagggctacgaaacgctgctgaacacc
aatatgggtctggaactggataatatggcacggctgctgcatatggcagtggactatgca
agaagcatcggctttaccggcgacttctacatcgagcccaagcccaaggagcctaccaag
catcagtatgattttgataccgcaaccgtgatcggcttcctgcgcaagtataatctggac
aaggacttcaagatgaacatcgaagccaaccacgcaacccttgcacagcacaccttccag
catgaactgcgggtagcacgggagaacggcttctttggctccatcgatgctaaccagggt
gacaccctgctgggctgggatacggatcagttccccactaatacctatgacgcagcactg
tgtatgtacgaggtactcaaggctggcggttttaccaatggcggtctgaactttgactcc
aaggcacggcgtggatcctttgagatggaggatatcttccacagctacattgccggtatg
gacacctttgcactgggtctgaagattgcgcagaagatgatcgatgacggacggatcgac
cagttcgtggctgatcggtatgcaagctggaacaccggcatcggtgcggatatcatttcc
ggcaaggcaaccatggcagatttggaggcttacgcactgagcaagggcgatgtgaccgca
tccctcaagagcggtcgtcaggaattgctggaaagcatcctgaacaatattatgttcaat
ctttaa

DBGET integrated database retrieval system