KEGG   Ruminococcus champanellensis: RUM_11420Help
Entry
RUM_11420         CDS       T02600                                 

Definition
PEP phosphonomutase and related enzymes (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
rch  Ruminococcus champanellensis
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rch00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    RUM_11420
Enzymes [BR:rch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     RUM_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1251874..1252746)
Genome map
AA seq 290 aa AA seqDB search
MHENPLGSLLKNGAPLRILEAVNGLEAYVAEHAFAPDSEGNQITFDGLWLSGLCHAAAAG
MPDDGRMPLSEKLTAVRTIRRVSQKPLLVDCDNGQGDFSHTARAYAKAGVSGLVVEDKCG
QKHNSLYGSARVQLLEDPRIFAQKLSDAKAHAPEILLFARLESLIAGQSMEDALERANIY
AKAGADGIVIHSLDKTGEQVLEFCHRCKQLLPEMPVACIPTMYPQLSCHTLHQAGVNMVI
YANHLTRSAYKAMCLTAGSILAAGSSGEADQQYCAPTTEILRITEEATHD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaaaatcccctgggcagtctgctgaaaaacggtgctccgctgcggattctggaa
gcggtcaatggactggaagcctatgtagcggagcatgcctttgccccagattcggaggga
aaccagattacctttgacggactgtggctcagcggtctgtgtcatgcagccgcagcaggt
atgccggacgacggacgcatgccgctttccgaaaagctgacggctgtccggacgatccgc
cgggtcagtcaaaagcccctgctggtggactgcgacaacgggcagggggacttttcccat
accgcaagggcatatgccaaggcaggagtatccggtctggtggtggaggacaaatgcgga
caaaagcacaactccctgtatggcagtgcccgtgtccagttgctggaggatccccggatc
tttgctcaaaagctatcggatgccaaagcccatgcacctgagatcctgctgtttgccaga
ctggaaagcctcattgccggacagagcatggaggacgcactggaacgggcgaatatctat
gccaaagccggtgcggacggcattgtgatccacagcctggacaaaaccggcgagcaggta
ctggaattttgtcatcggtgcaagcagctgctgccggaaatgccggtagcgtgcattccc
accatgtacccacagctgtcctgtcataccctgcaccaagcgggagtgaacatggtgatc
tacgcaaaccatctgacaagaagcgcttacaaagccatgtgcctgaccgccggatccatc
cttgccgccggcagcagtggggaggcggatcagcagtactgcgcacccacaacggaaatt
ctaaggatcacggaggaggcaacccatgattga

DBGET integrated database retrieval system