KEGG   Ruminococcus champanellensis: RUM_15850Help
Entry
RUM_15850         CDS       T02600                                 

Definition
(GenBank) Cellulase M and related proteins
Organism
rch  Ruminococcus champanellensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1722303..1723325
Genome map
AA seq 340 aa AA seqDB search
MELFERIRTLADASGVSGNETEAALTALEMLREFCPDAVYENGNVIGHLGVREPGKPHVL
IDAHIDQIGMIVTDIEENGFLRIGNVGGLDRRLMPAQSVLIHGRELIGGVICTIPPHLSG
GKDASVPKMEDLAVDTGYDQTQVSALVSRGDFVQFDTSCMPLLDDRMTGAALDDRCGVAA
ILRMLELLQGEKLPCSVTILFSSQEELGERGAKIAAYTVDPDIALAVDVSFGCTADDKPS
ETGELGKGSMIGISPTLSREVSNALIDAARAENLPYQLEVMEGLTSTNADRFSVARGGAK
ACTVSIPLKYMHTPVEVIDTRDVELTAKLLCAYLRRCSAC
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaactgttcgagaggatccgtactctggcggatgcgtccggggtctccggcaatgag
acagaggcagctctgaccgctttggagatgctgcgggaattctgcccggatgcggtgtat
gaaaatggcaatgtgatcggtcacctgggcgtccgggagcctggcaagccccatgtgctg
attgatgcccatatcgatcagatcggcatgatcgtaacggatattgaagaaaatggcttt
ctgcggatcggcaatgtgggtggtctggaccggcggctgatgccggcgcagtccgtgctg
atccatggcagggagctgatcggcggcgtgatctgcaccattcccccccacttgtctgga
gggaaggatgcttccgtgccgaaaatggaggatctggcagtggatacgggctatgaccag
acgcaggtttcggctctggtatcccggggggattttgtgcagtttgacaccagctgcatg
cccctgctggatgaccggatgactggtgccgccctggatgaccgatgcggcgtggctgcc
attctgcggatgctggagcttttgcagggggagaaactgccctgtagtgtgaccattctc
ttttccagccaggaggagctgggggaacggggcgcaaagattgccgcatatacggtggat
ccggacatcgcactggcggtggatgtgagcttcggctgtactgccgacgataagcccagt
gaaaccggggaattgggcaagggttccatgatcggcatttcccccaccctgtccagagag
gtgagcaatgccctcatagacgctgcccgggcagagaatctgccctatcagctggaggtc
atggagggactgacttctaccaatgcggatcggttcagcgtggcacgggggggcgcaaag
gcatgtaccgtgtccattcccctcaaatacatgcacaccccggtggaggttattgacacc
cgggatgtggaactgaccgcaaagctcctgtgtgcttatcttaggaggtgttctgcatgc
tga

DBGET integrated database retrieval system